Identifiers and Description

Gene Model Identifier

Contig7751.0.g12

Standard Name

N6AMT1

Aliases

Contig7751_0_g12

Description

Methyltransferase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002959303.999970367130025e-21zgc:92834, putative
SGDYDR140W0.000000000000006000101554955223MTQ2 SGDID:S000002547, Chr IV
from 734138-734803, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7751.0.g12(coding)
ATGAAAAAGATTCTACTGGATTCTGCTGCAGTTTCACTCACCTAAAATCTGCAGATTATA
GAAACGTCTATGAACCTAGTGAAGACAGTTTTCTCCTAATAGATGCTTTAGAATTAGATG
TTTTGCACATCAAAGACAATATAAATCCATTGTTTATACTTGAGGTTGGGCAGTGGAGTT
GTAATTAACAGTCTATAAATGATACTTAAGAAATAAAACATTCGTGAGTGTATTTATTAT
GGAGTTGACATCAATCAGAAAGCCTTAGATGCAACTAGGAGAACTGCCTAAGCCAATTAA
TGTTAAATTAATCTTTTGCAAATGAATTTCTGCGATAATATGGTACAGAGAATGAAGGGC
TAATTTGACATTCTTATCTTTAATCCTCCATATGTTGTGACGCCATAAGATGAGCTTATT
GAAGCCTAGTAAAAACAAGGTATTGAAGCTTCGTGGGCTGGAGGAGAAGATGGCATAGAA
GTGCTAATGAAATTTATACCACAGTCTTATGAATTAATATCAGAAAATGGGGCTTTTTAT
TTATTGCTGATTGAAGAAAACTTGAGAATATTAAAGAAAATTGGGAAATATTTTGATATT
GAGTATTTAGTTAAAAGAGAATGCCCTGGAGAAAGATAGATTATTCTTAGGTTGACAAAG
AAAAAGTAGAATTTGTGA


>Contig7751.0.g12(protein)
MKKILLDSAAVSLTQNLQIIETSMNLVKTVFSQQMLQNQMFCTSKTIQIHCLYLRLGSGV
VINSLQMILKKQNIRECIYYGVDINQKALDATRRTAQANQCQINLLQMNFCDNMVQRMKG
QFDILIFNPPYVVTPQDELIEAQQKQGIEASWAGGEDGIEVLMKFIPQSYELISENGAFY
LLLIEENLRILKKIGKYFDIEYLVKRECPGERQIILRLTKKKQNL