Identifiers and Description

Gene Model Identifier

Contig14143.0.g93

Standard Name

MYB8

Aliases

Contig14143_0_g93

Description

Myb-like DNA-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008423809.001131581050935e-57Myb-like DNA-binding domain co
ntaining protein
SGDYMR213W0.000000000010004361180063202CEF1 SGDID:S000004826, Chr XII
I from 693381-695153, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14143.0.g93(coding)
ATGTAACGTGAAAACACACCTCTATCAAGATTCAGCAGTCTATCATCCGCATCTCTTTTA
TTGCAAGTACTAAAGAACGAGCCTAACCTATAGATTAAACAGGAGGCGTCTCATAGACAA
GCTGAAGGCAAAGAAAATGCTGTTGCTCCGATTTCATTCAGGAAGCAGCAAAATTTGATT
CCTGAAGACCCCTAGAATAAGCGGCAATTACAAGGTACAACTACCCTATTGCATAAAATA
TTTGCATCTTAAAAGAAAAAGGTAGAATGGACCCCATTTGATGACGCAAAGCTGTTAAAA
TATGTTGAGAAGTTTGGCGACTAAAAATGGAATAAGATAAGCAAGTTTATGAGAGATCGC
TCAGAAATCTAATGTTTTAACCGTTGGTTAGAGCTTAAAGATACTTGCTTCGTGTCAAAA
GGTCCATGGACCAGGGAAGAAGATGAAATTCTTCGTTAAATGGTTGAGACCTAGGGTCCT
CGTAACTGGAGCACCGTTGCAGCTGCCTTACCAGGGAGAATAGGTAAGCAGTGTCGTGAG
AGATGGCACAACCACCTAGACCCATCTATCAAAAAGGAAAAGTGGTCTTAAGAGGAAGAT
AGAATCATCCTCTAAATGCACCTTGACATGGGAAATAGATGGTGTGAAATCGCAAAATAC
CTACCAGGTCGTACCGACAACGCCATAAAAAACCGATTCAACTCTAAGCTCAAGAAACAG
ATTCAAAGATAGGGTCACTTCGCGGCATCTTAACAGCTTGAGAGCTCAAAATCTGAGTAA
TACAAGTTAAAGCCCCCTTCCACCCCTTTGTCTGTTGAGTAGCAAATTCTTTTCCACTTA
AAGAAGAGAGACAAAAAGGGGCTTCTCAGGTTAATCGAAAAAAACTAAGGAAACGTAAGA
AGAGAACTAAGTTTGTAAACTACCGCCAGTTCCCACATCTCCTCAATGACTCCTTAATCA
AATACTAACTTGGCATCTAATGATTTAAATGAAGGCACAAGCTTTTCTTAAATTTCTCTT
TCACCCTCTTCTCAAATGACTTCCGTCGATAAAAATGAACCGATTTCATGCAACGAGGAA
AGTGAAAGCTATGCCAGCATTTCTGATTCTCAACTGTAACTCCCACTAACTCTGAATTCT
CATCAAAATAGCTTGACTGAGAAATTTGTCAACCATAATTTATCAAATTATTAAGGCAAC
TCTGATATTAAATTAGCAGCAAGGAAAATTTAATTTAATAGATACATTTGCATTCCTCAA
TTCCCATCTATTTATTACAATCCACTTAACTCCTGTTCACTACCTAAAAGCGAAGATCTC
TTAAGAAGCTTGATGTCAGGTATCATCTAATGA


>Contig14143.0.g93(protein)
MQRENTPLSRFSSLSSASLLLQVLKNEPNLQIKQEASHRQAEGKENAVAPISFRKQQNLI
PEDPQNKRQLQGTTTLLHKIFASQKKKVEWTPFDDAKLLKYVEKFGDQKWNKISKFMRDR
SEIQCFNRWLELKDTCFVSKGPWTREEDEILRQMVETQGPRNWSTVAAALPGRIGKQCRE
RWHNHLDPSIKKEKWSQEEDRIILQMHLDMGNRWCEIAKYLPGRTDNAIKNRFNSKLKKQ
IQRQGHFAASQQLESSKSEQYKLKPPSTPLSVEQQILFHLKKRDKKGLLRLIEKNQGNVR
RELSLQTTASSHISSMTPQSNTNLASNDLNEGTSFSQISLSPSSQMTSVDKNEPISCNEE
SESYASISDSQLQLPLTLNSHQNSLTEKFVNHNLSNYQGNSDIKLAARKIQFNRYICIPQ
FPSIYYNPLNSCSLPKSEDLLRSLMSGIIQ