Identifiers and Description

Gene Model Identifier

Contig1116.1.g101

Standard Name

MYB7

Aliases

Contig1116_1_g101

Description

Myb-like DNA-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005718906.999359373303508e-39Myb-like DNA-binding domain co
ntaining protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1116.1.g101(coding)
ATGTCAGGTGGAGGGATAAAAAGACAAGAAAAACTAAGTCAAAAATTGAGTAAAATATCT
CCGGAAAAACGCTAAAGTCATAAAGTTTTAATAGACAGTAGTGAGATAAAAGAAGAGGAA
GATAAAAATAAAAGTCAAAGCATTCGATATGACTCCATATCTCATTAAGATCTTAATGCC
GAAGAAGATTCTTCTGATTCTCAAGAAGAGGAAGTTGGTGGTAGTGACTAAGACCCAAAT
CAAGAGTTAGGCAGACGTCCAAACAAAGCCGGTTCGAGAAAGCTTTGGTCGGTTTCAGAT
GAAGCGATTGAGAATTTAGTTGACAAATTTGGGACTAAGAGATGGACTTATATTGCATAA
AAACTCAGAGATGATTTTAAGATTCAGGGAAGAACTGGAAAACAATGCAGAGAAAGGTAT
ACAAAGATTTTCATCAAACTAACTTATTTATTATGCTAATCAACCCTTAAACAACCACTT
CATGTTTATAGATGGCATAATCACTTAGATCCAGAAATAAAAAAGGATCCTATCACACCA
GAGGAGGAGCGTGTTATCTTCGAATCTCATAGGAAATATGGGAATAAATGGGCGGACATA
GCAAAACTACTACCTGGAAGGTCAGACAACAGTATTAAGAACTATTTCTACTCAACTTTG
CGGAAACACATTCGTCGAATAAACAAATCTCTACGCCAGTCCTAGATTGCTCGTAAGTTG
GGACTCAAAATGAAAAATCTGACATCAGAGCAACTTTATGAGATGGTTCGCAACCAAGAA
ATCACATATGAGAAGCTTCAATAGATGGATCCAAAGAGGTTTTAAGATCTGGAGTATACA
ATGAAACTTATATACAATCACGACTTACCATTTAATACTACTAGTTCTATTAATTAATCA
ATCACAAGTTAAGGCTAGGGTACCGATCGGAATGTTCTCAAAACTACGGAAGAATCTAAA
TAATAACATTAAATCAAACCAGAAACTCAACCTTCAGAGTAGATTGGAAAGCGAAGCAGA
GTAGGCAGTGACTTGTAACAAACCACACCCTCAAAACCCATAATAAACCAATAATTTTTC
AAAAATAAAATTGAATTACTTCAAGACCTCAATAAATTAGCAGAAATTAAGGAACCTACT
AACATAAAAAAAGACTTATTGGTCTAGCAATAAATAGAATAAGATAAATCATTTTAGAAC
ATAATAGAGGAAGATCAGTAGTTATATAGGGATTCACAGTCAACTCCTACTGCTCAATCT
AAAAGACGATCAAAACGATTGACTGGCAAGAAAAGACTGAATTATGAGGACTTAAATGAT
TAATGCGTTGATGTGATTAGACACATTTAATCTGATTAGAATATTCCTGTAAATATGGAT
GAAGGGCTAAGTAGTTCATAGAAATATAATTAGAGGATGTTGTAGAAAAACCAATTACGT
CACAGTTAGAACGTTTATGAAGATTATTAAAGATTCCAAAGAGCACCAATGATTAAAAGG
AAGAAATTTCTGACTGACGAAACTGTATCATTAGGGCAGAGCGATGATGAAAGACGTACC
GATATAAGAGAAACAAATAAAATCATATAATAAGATAGAAAAGAAGATAAAATATAATAT
AGTCAAACACCATAACCTATTGGAAAACAAGTAAAATTAGAGTAACAAGAAATAAAACAA
CACAATGAGTTAAATTTGCCTACAAATGAGCAGTTGTAAACCAAATAAGAGGATGAATCC
ATGAAAGATGAAACGACGGGCCAATAAGTCAACTAGAGAATTAGATAAAATAAATACAGA
TAAGACGACGAGCTATTTTTACGAGTTATGTCTGAATAAGTCAATTTTATTCCTTCTCCC
AGATAAAAATCAATTTAACTACCTTCTCCTCATCAAGATAAAGATTTAGAGCAAACTTAA
ATAGGAGATAAGGATAAAATTATGGCTTCATCTCAAGCTGTAGGTGGGGCCAGTACCCCT
CATGCTGGACTTGATGATTTGAAAAAAGCTTTAGAAATATAAAATTCTCTAGCTCATTAA
TCCTTGTAAGTTTAGGGTATAGGATTGAAGTCAGAGTAAATAGATTCTATCAATAATAGA
GCTGGTACTTTAACATAGAGCAACACACCTGCCAAGACATTTTTGTAGACGCCTACTAGT
TAAAGCTTAAAAAGCTAAAATCTCAAAATAGAATCAACACAGCCATCTTAGATCATATTT
TAACTTAATAATGAACAGAGCATTTAGTAACCGTTGTATATTCCACTTTCTCAAACTAAC
TATAAAGTCTTTCAGTCTCCAAGATTCTAGATTCAGTTTGAAGATGGTTAACCCTAAATA
CCACCGTAAAATGAAAACCAATCAAATTTAGAAGGAGTGTTGACTCCTGGAAACTACATA
TAATAGTCTTCTAGAAATCTTTTTCAGAGACCAAGACTTGCCTCAGAAGAAATATAATCG
ATCCCTTAATAATAAAAATTAGAAGAGGTCAAACAAGAGGAAAAGCCTTAATAAAATCAA
TAGCAACAATAAATGTAGCAGTAACAAACAGTTGATTAAACTATACAATAATCAATGGGA
AAATAACTCTTAACTGCTTAGAACTTGAATAACTAATTTAACCCATTTGCAATTAAACCT
TTAAGGCTAGACTATAGAAGTATTTATGGAATGTCACCGCTGTCAAGTGTTTAGACATCG
TATACCGTCCCATCGCCTTATGCTATCCCATCTCCTTACACCACTTTGACCTCACCCTAT
ACATTACATCTACAGTCACCTTCTATTCAATTTCAGAATGAATTAATGATGAATTAGAAA
CAGTTTTAACAAGTCTAGCCATAAAAGATTGTCATGCAGAGCCCACATAGGTTCATGCCT
GGGTAACAGTAATATGTTTTAGTACCAGTCATGCCTAGCCCATCAGCTGCCTAATTCCCT
GGGGTCTTGTAGTCACCTCTATAATTCTTGTAGAGATAGCAGAGATATCAATAAAACTAA
GGAATTATTAATCCACCTAACCCTGTTTTGAATGCCAATCGTACAGCTTAAATGTTGAAC
TAACAGGGTTAACTGACTAAGTAATCAAGTAATAGTTCTTAACTAACAAATGAATCAAAA
ATGTAGCCGCCATCCACTTCACAACAAAAGGAGTAGCAGTAATAAAATCCAAATGAATGA


>Contig1116.1.g101(protein)
MSGGGIKRQEKLSQKLSKISPEKRQSHKVLIDSSEIKEEEDKNKSQSIRYDSISHQDLNA
EEDSSDSQEEEVGGSDQDPNQELGRRPNKAGSRKLWSVSDEAIENLVDKFGTKRWTYIAQ
KLRDDFKIQGRTGKQCRERYTKIFIKLTYLLCQSTLKQPLHVYRWHNHLDPEIKKDPITP
EEERVIFESHRKYGNKWADIAKLLPGRSDNSIKNYFYSTLRKHIRRINKSLRQSQIARKL
GLKMKNLTSEQLYEMVRNQEITYEKLQQMDPKRFQDLEYTMKLIYNHDLPFNTTSSINQS
ITSQGQGTDRNVLKTTEESKQQHQIKPETQPSEQIGKRSRVGSDLQQTTPSKPIINQQFF
KNKIELLQDLNKLAEIKEPTNIKKDLLVQQQIEQDKSFQNIIEEDQQLYRDSQSTPTAQS
KRRSKRLTGKKRLNYEDLNDQCVDVIRHIQSDQNIPVNMDEGLSSSQKYNQRMLQKNQLR
HSQNVYEDYQRFQRAPMIKRKKFLTDETVSLGQSDDERRTDIRETNKIIQQDRKEDKIQY
SQTPQPIGKQVKLEQQEIKQHNELNLPTNEQLQTKQEDESMKDETTGQQVNQRIRQNKYR
QDDELFLRVMSEQVNFIPSPRQKSIQLPSPHQDKDLEQTQIGDKDKIMASSQAVGGASTP
HAGLDDLKKALEIQNSLAHQSLQVQGIGLKSEQIDSINNRAGTLTQSNTPAKTFLQTPTS
QSLKSQNLKIESTQPSQIIFQLNNEQSIQQPLYIPLSQTNYKVFQSPRFQIQFEDGQPQI
PPQNENQSNLEGVLTPGNYIQQSSRNLFQRPRLASEEIQSIPQQQKLEEVKQEEKPQQNQ
QQQQMQQQQTVDQTIQQSMGKQLLTAQNLNNQFNPFAIKPLRLDYRSIYGMSPLSSVQTS
YTVPSPYAIPSPYTTLTSPYTLHLQSPSIQFQNELMMNQKQFQQVQPQKIVMQSPHRFMP
GQQQYVLVPVMPSPSAAQFPGVLQSPLQFLQRQQRYQQNQGIINPPNPVLNANRTAQMLN
QQGQLTKQSSNSSQLTNESKMQPPSTSQQKEQQQQNPNE