Identifiers and Description

Gene Model Identifier

Contig17067.0.g78

Standard Name

MYB50

Aliases

Contig17067_0_g78

Description

Myb-like DNA-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17067.0.g78(coding)
ATGCCAAATTAAATGGAAAAAGCAAAGCTCACCAAGGACACCTACATTAAGACCTTTTCA
TTTTTGACTAAAAGTGAAGTATTCTAACTTCAGCAACTTTGTCACACACAACAAGATTTC
ATTGCTGATAAGTTCGTGCACATTCAAATGGAGATGCTTCGTAAATCTGAGAAAGAAACT
TTTGATATTTATGGAGATGGGGAAGAGCAGAAATAACCAGTGAAGAAAGACTAAAAAGAT
CAAGCTCAATTGACATGGAGACCAGAGCATAGTTTCATCTACAAGTTTGAGTTGAAGCCT
GAAATGTTGGAGATCTTGAAGTCCTCAAAAATTTTCAAAAGCATAAATTTGAATCATGTG
GATGTCTTGATCATGAATTTCTAAAATATCAAATTGCTACCAGATCTTTTTAAGCTACTA
ATTCAGAAACTCTATAGAAAAGATATCTCACAGGATAAGTCAAAGAAAGCCAAGATGGAA
TTGGATTTGATTGATACATCTACAAGCATTAAAAGTGTCAACCCTGAAATGTCTGGAAAG
TTGATTACCAATCAAAAGATAAATGTCAATTTCAGTTTCTTAGGAGATGGTCGTTGGGAA
GACAGCTTTTATGATTAGCATGTGATAAAAGGCAACATTAATAAACTCTCTGCTGAAGAA
GAAAAGGAAATCACTAACTCTCTCAATGATTTATTTGATGAGCACACAAGAAGCCTCTTT
CATTTCACTTACAACCTTTAAAATAAAAGGGTTTACTCAAATGTTATTGTAAATCTACTG
AGAGTTATTCCTTTTTTACTTGATGAGTGTGAAGCTAACAGAAACACCTACTGCTTGTAA
AATTGGAATTAAATTTCTAAGAAGTTCAAGAGAATGAACATTCAAGATAGAACTCTTAAC
ATGTGTATGAATCAGAACAATTCTAAATATATTTATGATAATATTGAGCAGCTTTCACTT
GTAAATGTCAAAGATTTTCCATTCCCCTTGTGCTACCCAAATCTAAGAAAGCTCTAAATC
GCAGATTTTTTCACACCCAAGTACATTTCATAATAATTGACCAATCATTTCAAGTCCAAA
ACTCAAGAATCAGCTGCTGCCATGACAGATGTTGAATAAGAATTGATCGATACTTCTACT
AATAATTCTAGCAATAATGGTGGAAGTTATGCTAATGTGTTTTTCCCTTGTTTACAAGAG
GTACAACTTGTGTACTTCTTTGCTACCCCAAATCCCTCTGGAGACATTTCAAAAGAACTT
GATAAGAGAACCAAAGACCTCGTTTTCCTGCTTGATGGTTTAAGCAATGCCAAGTCTATT
AAGATCAAGCTTGTCTTTAAGGCTTAAAAGGCTTTCACAAAGCCCGAAGATGTTGAAGAG
TTTGTTAAGTAATTCGACAGAGATTACAAAATGGTGGAAGTGACCTACTGCAAAATTCAG
AACAACTACTTCTCTCACAAAGCCAACAGAGAAGCCAAGCAGATGATCGACGTTATGGCT
AAAGAAAATCCAATGGAAGAAGATTAAGTGCTTATCTATAAGAAAAATATCGATGAGTCA
GATGTGTTGGTGAGTCTTGACACTAAGTGA


>Contig17067.0.g78(protein)
MPNQMEKAKLTKDTYIKTFSFLTKSEVFQLQQLCHTQQDFIADKFVHIQMEMLRKSEKET
FDIYGDGEEQKQPVKKDQKDQAQLTWRPEHSFIYKFELKPEMLEILKSSKIFKSINLNHV
DVLIMNFQNIKLLPDLFKLLIQKLYRKDISQDKSKKAKMELDLIDTSTSIKSVNPEMSGK
LITNQKINVNFSFLGDGRWEDSFYDQHVIKGNINKLSAEEEKEITNSLNDLFDEHTRSLF
HFTYNLQNKRVYSNVIVNLLRVIPFLLDECEANRNTYCLQNWNQISKKFKRMNIQDRTLN
MCMNQNNSKYIYDNIEQLSLVNVKDFPFPLCYPNLRKLQIADFFTPKYISQQLTNHFKSK
TQESAAAMTDVEQELIDTSTNNSSNNGGSYANVFFPCLQEVQLVYFFATPNPSGDISKEL
DKRTKDLVFLLDGLSNAKSIKIKLVFKAQKAFTKPEDVEEFVKQFDRDYKMVEVTYCKIQ
NNYFSHKANREAKQMIDVMAKENPMEEDQVLIYKKNIDESDVLVSLDTK