Identifiers and Description

Gene Model Identifier

Contig17346.0.g53

Standard Name

MYB5

Aliases

Contig17346_0_g53

Description

Myb-like DNA-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000523601.0004572433669413e-23Myb-like DNA-binding domain co
ntaining protein
SGDYKR099W0.000000000029994712494008525BAS1 SGDID:S000001807, Chr XI
from 635851-638286, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17346.0.g53(coding)
ATGAAATTGCCTAATCTCTAAGGTCTTTTAAATGATAATATTGAGTAAAAGCTTAAAGAG
ATTAATTAAAGAGACAAGTCGAAGTCTTAAAATAGTAAGAATCTGAAGAAATTTGAGTTA
AACAATAAAAGGAAAATTCCAAATATTAAATATGCGGATGATTCTGATGATTAAGTCTCA
GTTCTCTCAACTATTTATGAAGAAGTTTGTGAAAACGAAGAATTTGAGGGAGTTATGTCA
GATCCTTTGTTTCAAGTTATACCTCAGCATGAAAATAGCGTAGCAGTGTTCTTTAATATT
GCCAGTCTTTTTCGAAATAGTCACTTTACAGTGACGCCTGAGTAGTTCGGTGATAATGCA
AAACATTCGCATAGATGGTCTAATATAGATGATAACAAGTTGCTCAAAGCCTTTTAGAAG
TATGAGAATAACTGGACAAAAATCTAGATGGAAATGCGCTTAGCAAAAGCAGATGCTGAG
GATATCAAAGACAGATATAAGAGACTTACTGAAGCCACTGTCAAAGGCACTTGGACATAG
GAAGAAGATAGTATTATAATGCGAGAGTATAAAAAACTTGGGAGAAATTGGGGTTTAATA
GCTAAGAAGGTGCCTGGAAGAAGTGGCAAGTAAATTAGAGAAAGATATGTAAATTATTTG
GAAAAGAAAGATAACATTAAGAAAGAGTAGTTCAGTGAAGAGGAAGATGATCTGATTATG
AAATATTTCGATATATACCCTCATGATTGGAATAAGATATCGGAAAATGTAAAGACGAAA
TCTGCCAGCTAAATAAAGAAAAGATTTGTAAACTTTTTGAGAGAAAAAAAACTAGAAAGT
TCGAGTACTATGTCTACTGAAAACTCAAGTGTAAATAATATATAAATAGATAACGTTAGT
GAAATAAATAACAGTGTTGATAGCTTGATAGACCCAATCGGAGACTTTTTTAGGCAAAGA
CTTTCTCTTATGAAATCTAGTACAATGACTTAAATTTAGGATTTCGATCAGGAAAACTAA
GAGGGTGGCACTAATTAATGGTTGCTAAAGAAAAGTTCACTTGAAGAAAATAAATAAGTT
CTTAACATGTTTGAAAATTAAGGGATGCTTGGGATAGAGCAATCTAATACATGTGAATCT
CCTCAAAAGAACAATTACTTATAAATAAACTCGTTTGGAACATTCAATCGAAGTGTTTCC
GGGCTTTCTTCAAACATTGATGACGAATAATCGCAGTAAGACCCCGAGTATCAAAACATG
TAATTTAATTACAATACTTAAGGTTCAATTAATTCTCCATCTTAGCAATAGCATTCTCGC
AAGAGTTAACTTTTGTAACCTGGAAATAATTTCTTAGTCCCAAGTTTATTCAAGTCCTAA
AAAACTCAAATGAACAATAGCAGCTTTAAAAAATCCTACTCCTCTAACAAACAAATGACT
AAATATAACAAGAATGAAAGTCCGTCTGCACTAAGGCTTAACTCTTAAAATCTCAGTGTG
AGATCCAAAATTACAAACAATACTAACACACCAAGAGAAAATTCTAGCACTTTCAGTTAG
GGTGATGAATCAGAATTTTAAGGTGGCTCTGGACAAGGTCTCTTTGATTTCGATTATTTA
TTAATGAGTGATTCTTCTGTGAATAACGACAGATCTGACTGCGGGTCTAACTTTGAGACA
TCAATGGTGTTTTAACCCTCTCCTAGAGGAAGTTTTGGGGGCTTTGATATATAAGTTACA
ACTCTTCAGTCATGA


>Contig17346.0.g53(protein)
MKLPNLQGLLNDNIEQKLKEINQRDKSKSQNSKNLKKFELNNKRKIPNIKYADDSDDQVS
VLSTIYEEVCENEEFEGVMSDPLFQVIPQHENSVAVFFNIASLFRNSHFTVTPEQFGDNA
KHSHRWSNIDDNKLLKAFQKYENNWTKIQMEMRLAKADAEDIKDRYKRLTEATVKGTWTQ
EEDSIIMREYKKLGRNWGLIAKKVPGRSGKQIRERYVNYLEKKDNIKKEQFSEEEDDLIM
KYFDIYPHDWNKISENVKTKSASQIKKRFVNFLREKKLESSSTMSTENSSVNNIQIDNVS
EINNSVDSLIDPIGDFFRQRLSLMKSSTMTQIQDFDQENQEGGTNQWLLKKSSLEENKQV
LNMFENQGMLGIEQSNTCESPQKNNYLQINSFGTFNRSVSGLSSNIDDEQSQQDPEYQNM
QFNYNTQGSINSPSQQQHSRKSQLLQPGNNFLVPSLFKSQKTQMNNSSFKKSYSSNKQMT
KYNKNESPSALRLNSQNLSVRSKITNNTNTPRENSSTFSQGDESEFQGGSGQGLFDFDYL
LMSDSSVNNDRSDCGSNFETSMVFQPSPRGSFGGFDIQVTTLQS