Identifiers and Description

Gene Model Identifier

Contig284.1.g59

Standard Name

MYB43

Aliases

Contig284_1_g59

Description

Myb-like DNA-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000523600.00000000030007160092483236Myb-like DNA-binding domain co
ntaining protein
SGDYMR213W0.000030009396760408108CEF1 SGDID:S000004826, Chr XII
I from 693381-695153, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig284.1.g59(coding)
ATGCAAAATCTGCAAAGAAGCTTGAGCAATAATAATTTAAACCCTAAAACCCACAATAAT
CAAGACGACGATTAATCTCAATTTGAGAAAACAGATGCGGGTCTCACACAAGCAGAGAAG
GCTAGTGTTTTCGATTCAACGGGAGATAATTCATAAAATTCCCAGAAAACCACAAATGAA
AATTACATACCACAGCACATATCAATTAGAAAACCCACATTTACTTAGTAAAATTAAACA
AGGCAAAATGGTATTGTATCAGGAATAATGTCAATCTTATGTGGTTGCTGCGAGACAACA
AACAGCAGAGAAATTTAAGAATAGGAGCTTCTGATGAATTCTAACCTCATACCCCTGCAC
AAAATAGATGGCAAGTCCCCTCCCTATTCTATTGGATAGAAGCGCAATCGAGAAATCTAT
GGCTTAAGCCCGAATCCCTCAGGAATTAATAATACAGGAGGGGAATCATCCAAAGTACAA
CTTGCATCTTAACTACTTAATAAAAAATTATAAACAGATGACGCATTTCTTAACAACTAG
TAAGCTAAGAAATCTGACAGCAAGCAGGAAAGTTACTACTCTCAAACAAATATCCTTTCT
AAAGCTCTAGAAGGCCTAGAGGAAAACTTAACTGATAGGAAATTCAGAGATGAGTCTTTG
AACTTAGAAACACTTTACACCATGTACGAATGGCAATAGAGAATTGAATCTTAAATGATT
TTAAAACGAAAGTAGGAATAATAAATATATGGTAAAATTAATAATAATGAGAATAGTTAA
TAGTAATTACTAAAGAATGAACTCTCAACTAACGAACATACTGATATTGACTCACTCTAC
GTTACAAGGAAGCATAGAAAAAATGTAAATGAGTGGACAATTAACGATGACGACAAACTT
TTAACAGCTTATTCGTAGTTCAAATCAAATTGGCCAAGAGTATCATTATTCATAGGAACT
GGCAAGGACGCTTAATAATGCAGAAAGCGATATTAATATTTAAAATCGAAGAATGTGATT
GATCTATTGACTAGTAGTTCTATTAGTCATAAACACTAGAAGAGCTAATAAACATCTGTC
ATTGGTAAAGAGTGTAAAAATTTGAATTAAAGCGATTAATGGGACTCTTAAACTGATTCA
AAAATTATTGAGCTGGTAAAAAAACTTGGTTACAATTGGAAATAGATCGCCAACTTTATA
AAAGGCAAAAATGCTAGATAAATCGGGGATAGATTTCATAATGTTTTGAAAGTGAAGCTT
AGTGAACCGAAGGAATTCTCTACCATCGAAGACAAAAAGCTGCTTGAGACCTATGAGCTC
TATCCCAATAACTGGAAAGAAATTTTGAAACAACTCCCTGGTAGAAATACTGCTATGATA
AAGGAAAGGTATCATGTAATAAAAGAGCAGCAATTAAGTTCAGATTTAGCGTTTCTCTAT
AAAAGAGGGAAAACGACGAGATCAGAAGACTTTGATGCCTCTTAATCAACAAGAATCCGA
ACTTCTACTGATATAGAAACTAAAGATGGTACCTTTACAAACAATGACGGCCAACTCTAT
GGAAGCTGGGATCACCTTGATGAAAATGATGCCTCAATAAATGACAATAGTAACAATAAT
GTCAACTTCCTGCTTGATTACGGTAACAACACACAAACTGTTCAAAATAACGATTCAAAT
TCTTCAACTCAGTTAGAAAGAAAGGAAAGCAAAAATCATAAAAACATCACACCAACTGTG
CAAACAATTAGCATCAGATTCTCACCAGTTATTAGCACACGATTTAATCGTGACGACAGT
AGAACTATGAGTATGGGCAGTGTCACTCCATTTGAACCATAGGTCAAAACCCTGCAAAAG
TAGAAATACTACGCTAAATTATAACAATCTGGTAGCTTGGGAAGTGAACAATAAAAACTG
TTTCTTAACCCAAACGCAAACGAGTATGACTTTGTCATGAAATAAAGCAGCTCATCTGGC
TTGAGCAATTCCCACAGCTTTATTCAAAATTTCAATGAAAACATGAGTCAAACTTAATCT
TAAGTTTGGCGCCGTGGTAGCTTGTTCTCTCAAGGACAATAGTCATCTAAGCACTCGATG
GCCTCAATGATGAACAAAGAGTTACATAGCAGCGGTGTGTCCCATTTCTACAACGCTCGT
ATGTCTACTCTTTAAGAAGAAGACATTAAGTCGATAAGCACTCATCTGGAAAGACTCTCT
ATTGGAGGAAGATCAAATATTTCAATGGCAAACGACTTCGAATCATAATAATGA


>Contig284.1.g59(protein)
MQNLQRSLSNNNLNPKTHNNQDDDQSQFEKTDAGLTQAEKASVFDSTGDNSQNSQKTTNE
NYIPQHISIRKPTFTQQNQTRQNGIVSGIMSILCGCCETTNSREIQEQELLMNSNLIPLH
KIDGKSPPYSIGQKRNREIYGLSPNPSGINNTGGESSKVQLASQLLNKKLQTDDAFLNNQ
QAKKSDSKQESYYSQTNILSKALEGLEENLTDRKFRDESLNLETLYTMYEWQQRIESQMI
LKRKQEQQIYGKINNNENSQQQLLKNELSTNEHTDIDSLYVTRKHRKNVNEWTINDDDKL
LTAYSQFKSNWPRVSLFIGTGKDAQQCRKRYQYLKSKNVIDLLTSSSISHKHQKSQQTSV
IGKECKNLNQSDQWDSQTDSKIIELVKKLGYNWKQIANFIKGKNARQIGDRFHNVLKVKL
SEPKEFSTIEDKKLLETYELYPNNWKEILKQLPGRNTAMIKERYHVIKEQQLSSDLAFLY
KRGKTTRSEDFDASQSTRIRTSTDIETKDGTFTNNDGQLYGSWDHLDENDASINDNSNNN
VNFLLDYGNNTQTVQNNDSNSSTQLERKESKNHKNITPTVQTISIRFSPVISTRFNRDDS
RTMSMGSVTPFEPQVKTLQKQKYYAKLQQSGSLGSEQQKLFLNPNANEYDFVMKQSSSSG
LSNSHSFIQNFNENMSQTQSQVWRRGSLFSQGQQSSKHSMASMMNKELHSSGVSHFYNAR
MSTLQEEDIKSISTHLERLSIGGRSNISMANDFESQQ