Identifiers and Description

Gene Model Identifier

Contig9482.0.g62

Standard Name

MYB38

Aliases

Contig9482_0_g62

Description

Myb-like DNA-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006272300.0004000184047659232Myb-like DNA-binding domain co
ntaining protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9482.0.g62(coding)
ATGCCAAAACAATTAATTAATAGTTACAAACAAATATAAAATGATAAGATTCGCACTTCT
TGTATACCAACTGACCTCACATCATAAAATGTGAAAACATACAATTAAGCATTGATTCAG
TCTGCTTGCTATCACAAACTGCACCAGGAATTAACTGAGTAATTAGAAGATGCTGATAGT
AGAATAGACGAGGAGTTAATAGAAGCTTAAATTTAGCTTAAGAATTTAGCTCAAGAATTA
ATGGACTCAGATTGCATAAGAGCAGGTTAAGATGGCTAGATCCTAAAATTATAAAATTCA
TTAAATATCAATATGGTCCAGGTATCCCGATAGAACACAGGCAGTCTTGCTAATATTTCA
CAATCATACAATTTAAGGGAAGAATTAAAGGAGGTAATTATGGATGAACTAAAAAAACAA
GCAACTTGCACTAATTTTACTAATGATCAGAAAATAACTCCTATATGTTACGAGAGAATT
ATAGGTTAAGACTAGGATAAAATTACTAAGAATGTCCTTAAAAGTGATGGAATTCATCCT
TCATTAGACAATTCATATTTAACAGAGCTTGAGTTAGAGCCCTCTACTTATACTGAAGCC
AGAAAATTATTACAGCCTTAATTATTTGACATGAATTTCTGCGTTTATGATTTCAAGCCA
GTCAATCCAGGATTCTTGTTGCTCTAGAGATTGGATTATATGACTAAGCAATAAAAGATT
AAGAACTATATTCGAAATTAATTCAGAGAAAGAGTTGATGAGATTAAAATTAATAACAGT
GTTTTTGTCAATCAAACTCAATAATGGTGTACAAACAGTGAAATACAAAAGAGAACTATC
GATAAATAGCTAAAAATGCGATATCCAGACCTCTTTGATGAGTTCTAATTAGAGCAAAAG
CACCTAACTGGAATTTTTAGTAAATTTTATATAACCAGTAACTTTCTCCTTCTAGATGCA
TACCCAGGCTATTTCCCTCATTTATTAGGCAGAGCAACTACTCAGTAAGTTTAAAACTAA
GACGATGACGAAGAGGAATGGGATGATTTCTAAAGATTCAAGGATAACAAGGCAGACATA
AGCTTAAATAGATTTAGGTTATACAAGCAATTCATTCATTAAGAGCCAAGCAAAGACTAG
CTGATAAAAAATCCACTCGAGTACGAACTTGAGTATAAAAAGCGCATGATTTGGACTATT
AAAGATATAGAAACTTTCCTGAAAGCTATTTTGGAAAATCCCCCAGACTTTTGGCAAATT
GGAAAGTACCTACCTCACAAAACTTCAAAAGAATTGAGTTTCTTTTATATGGCATTTAAG
AAGCTTTTCAATTTAAAGAAACATTTCTAGACTTTAAGAGTTGCTTCAGGCTTACCTTCA
TAAGCAGTTCGAAGCTTAAGTGAGCCAAGAAGAAAGATAAAAGAACAAGAAAAAATTGTT
GATCAGAAGCTTAGTCACTATCATTTCAATACCTTTAAAGTTTCTGAATATTAAAAAATT
GAGATCAATGAATAGGACCCCATTTTTTACTTTGAAGATGTAGAACGAAGAGGTAACAGA
ATTTTAGATTTCTGCCAAAATTAATTGTCTTTCGAAAACCCTGATCTAAGTTGGCCAGCT
TAAAATATGACTGCAAAAATATCATTCTACATCAATCTGATGTAAAGCTCTAAGTAATCA
ATGCCATAGTGCCAAATTAAGAATGTTTTAGTTGCCAAAGATGAATAGCAAAGCCTCTTA
AGAAAAAGAAACTTCACAGAATTTTTCAAAAATACTGGAGATAGAGACATCAGCAAATTA
GTATTGTCAAAACAGGTTATTGAAGATTATGGTCATCAAAATAATAAGAGGTAGAGAATT
ACTTCAAGCAATATTGAGAGTTAGAACTTTAACAGCGCTCAATCGCCATTCACCATCAAT
CAGTAGTCGAATGTTTATGAGGCTAGATTGAGTGATAATAATTTTTCAAGTTATTCACTA
ATGAATCAAGCAAATAACTCCTTCCCGAATTTGATATAGAACAATAAGCCGCAACACTTC
TACTAATCTCTCCCTCACAATTCTTTCACAGAGAAGTATGTGGAGAATTTAAATGGTAAA
ACCAATTCGAAGATCATGAACTACCTTGCTAAGAGGCATTAATAATAAAATTTGTTGGTT
CCCTAGCTTTCTTAATTTTACTAATAGCAGTAAAACAATTAGACTCATAGCTCAGACAAT
TCTATATCTAATAGGGATTTGCAAGTAGGCACAATTAGCGCAGTACGGCAATAGCAAAAT
TTGATGCTGACTGGTGATCACCCTTAGGAATATGCCACAGTGGAAAGAGATAAAGAGTTA
TTGAGAAGTAATTAAGGTCCAAAATCAAGTAACAATCAAATAATTGTCATTGAGAGTAGT
TCTGAAAATGAATCGTAAGAATTTGGGCAAGATGATGATGAAATCACGAGCAGACAAAGA
AAAGGTCTATTGTAATGGCAAGATGATGAGAAAGAGAAATTTATACTATTGCTACAAAAG
CATGGGAGAGATTGGAATGCTATTGCAAATGAGTTGCCAAGAAAAACAGACAAACAATGC
AGAAATTACTTCCAGAACTACAAGCATAAACTCAATTTGCAGCAGTATCTATCAGAGGGA
AGTATGTATTTATCTGCAACTTCAAAAAATGAAGTAAAATTTAGGTAGGATTGA


>Contig9482.0.g62(protein)
MPKQLINSYKQIQNDKIRTSCIPTDLTSQNVKTYNQALIQSACYHKLHQELTEQLEDADS
RIDEELIEAQIQLKNLAQELMDSDCIRAGQDGQILKLQNSLNINMVQVSRQNTGSLANIS
QSYNLREELKEVIMDELKKQATCTNFTNDQKITPICYERIIGQDQDKITKNVLKSDGIHP
SLDNSYLTELELEPSTYTEARKLLQPQLFDMNFCVYDFKPVNPGFLLLQRLDYMTKQQKI
KNYIRNQFRERVDEIKINNSVFVNQTQQWCTNSEIQKRTIDKQLKMRYPDLFDEFQLEQK
HLTGIFSKFYITSNFLLLDAYPGYFPHLLGRATTQQVQNQDDDEEEWDDFQRFKDNKADI
SLNRFRLYKQFIHQEPSKDQLIKNPLEYELEYKKRMIWTIKDIETFLKAILENPPDFWQI
GKYLPHKTSKELSFFYMAFKKLFNLKKHFQTLRVASGLPSQAVRSLSEPRRKIKEQEKIV
DQKLSHYHFNTFKVSEYQKIEINEQDPIFYFEDVERRGNRILDFCQNQLSFENPDLSWPA
QNMTAKISFYINLMQSSKQSMPQCQIKNVLVAKDEQQSLLRKRNFTEFFKNTGDRDISKL
VLSKQVIEDYGHQNNKRQRITSSNIESQNFNSAQSPFTINQQSNVYEARLSDNNFSSYSL
MNQANNSFPNLIQNNKPQHFYQSLPHNSFTEKYVENLNGKTNSKIMNYLAKRHQQQNLLV
PQLSQFYQQQQNNQTHSSDNSISNRDLQVGTISAVRQQQNLMLTGDHPQEYATVERDKEL
LRSNQGPKSSNNQIIVIESSSENESQEFGQDDDEITSRQRKGLLQWQDDEKEKFILLLQK
HGRDWNAIANELPRKTDKQCRNYFQNYKHKLNLQQYLSEGSMYLSATSKNEVKFRQD