Identifiers and Description

Gene Model Identifier

Contig12988.0.g51

Standard Name

MYB35

Aliases

Contig12988_0_g51

Description

Myb-like DNA-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00249 ) Myb-like DNA-binding domain
  • ( pfam07384 ) Protein of unknown function (DUF1497)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007216002.0004286606204839e-16myb-like DNA-binding domain, S
HAQKYF class fa...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12988.0.g51(coding)
ATGATGGCGAATGATTTAATTATTGATCAGGAGAGAGACAACTCTTCCTCTAATTTATAG
ACCTATGAACCGATTAAACACATCTCAAACCCCTAAGAAGAGAGCTTCGGGGACGAGGAA
CCTAACATGGTGGGAGCTCAGTCGAAATCAGACCTTTAAAAGAGAGATGGGTCAGAAGGT
ATACACGGAAGCAGCGACTTCAAACTAGATAATTCTTAGCAATAGGCATCATCAAGTTTA
ATCTAGCTACCAGCCACTAACCAAGCTAGAAAACCTTACTCAAGAGGGAAGGATCGAAAA
TCTCGAAAGGAGAGCGTTGCCTCTAACACTGGGCCAGACGGCAAGAAGAATGGACGTTGG
TCTATGATGGAACACGTTAGATTTTTAGAGGCCCTTAAAAACTATGGAAAGAATTGGAAA
AAAGTAGAAGACTATGTCGCCACAAGGACCAGCACACAGGCAAGATCACATGCCTAGAAA
TTCTTTGCAAATATCATCAAATCAAGCATGACAATGGAAGAGTTTTTAGAGAAAATCTCG
TACGATGCCATCAACCAACTTAGAAGGATTGCGCAAAAAAGTAGTGATAAAATTAAAAAT
GGAGGAGGAGATGAAGATGAGATGAGCGAACCTGAAATTTTGAAACTACTCATGATGCAC
ATGTCAAAAAATCATCATGAAGATGAGCTGGAAGCATTCGGTGACCCTGAATTTAAGAAG
CGTAGCACTGAGGAAAACTTAAGCGAAGATTTTGAAGTTGAGCAAAACCTCAACAGCGAA
AGTATCAATATTCCTGATGTAAAAAGCAGAAAAACTTCATTCGTGAACCCTAACAACAAA
AGGAAAAGATCAGCTAAGATTAAGACCCAAAACTTGAAAAGGAGGTTTTAGAGGAATACA
AACAAGAAGTAGTCGGCTAACTATGAGCAAATGAACTTTGGAGCTGCAACTATTAAGGCT
CAAAGCTAAATTGAGATTGATTAGAAATCAATATTTGAACCTAATCACAGTATTGAAAAT
CGTGAAAATGAGCTTTTAACCCCTAATGCTACTACTAGGACTAATAGAAGAGTTCAAAAA
ATAAGTAGCTAGTTTATTAGTTTCTAGAACGACTTTGAAGGTAATCACTAGTTTGCTTTC
AATAGCAATTTCGAAGAGCTGCATGAAAAAATTAAACCCTAAAGCTTGATTCATGAGGAT
CACCATCATGAACTTAATCTTTCTGCTAGACCTATTGTACCATAACAATCTCATGGCTTA
GCCATGGACTTAAACTTTACTCCTTAGAGCCACTTTAACTCAGTCAATCCTATTCATTTG
CCCTTTTAACACCTCGCAGCTACTAACAATTCAAGCATGATCAAAAACCTTAACTTGATG
GGTGATAATTTCAGTAGAAGGTAGTCTAGAATTTCCTAAGACCTACTAGCTGGTCCTGGA
TCTATTCATAATAACTAGCATCATCTATCTAACAACATAACCAACTTGATGATGGAAAGA
TCTAGAGGAGGCTCTTCTTTTGATATCAATGACTGCTTTACTTCTAGAGATCACTAGGGT
ATAGATGACTCAGTTAACCACCACAATGGAAGTGTTTGCAAAAATGCATCCTCTTCTGCT
GGTGGCTTTAACTCAAGCCTCTTCCGTAGGCCAAATCAGCTTCATCACTAACTCCCAGCT
TTTCAAAGCTGA


>Contig12988.0.g51(protein)
MMANDLIIDQERDNSSSNLQTYEPIKHISNPQEESFGDEEPNMVGAQSKSDLQKRDGSEG
IHGSSDFKLDNSQQQASSSLIQLPATNQARKPYSRGKDRKSRKESVASNTGPDGKKNGRW
SMMEHVRFLEALKNYGKNWKKVEDYVATRTSTQARSHAQKFFANIIKSSMTMEEFLEKIS
YDAINQLRRIAQKSSDKIKNGGGDEDEMSEPEILKLLMMHMSKNHHEDELEAFGDPEFKK
RSTEENLSEDFEVEQNLNSESINIPDVKSRKTSFVNPNNKRKRSAKIKTQNLKRRFQRNT
NKKQSANYEQMNFGAATIKAQSQIEIDQKSIFEPNHSIENRENELLTPNATTRTNRRVQK
ISSQFISFQNDFEGNHQFAFNSNFEELHEKIKPQSLIHEDHHHELNLSARPIVPQQSHGL
AMDLNFTPQSHFNSVNPIHLPFQHLAATNNSSMIKNLNLMGDNFSRRQSRISQDLLAGPG
SIHNNQHHLSNNITNLMMERSRGGSSFDINDCFTSRDHQGIDDSVNHHNGSVCKNASSSA
GGFNSSLFRRPNQLHHQLPAFQS