Identifiers and Description

Gene Model Identifier

Contig13085.0.g100

Standard Name

MYB34

Aliases

Contig13085_0_g100

Description

Myb-like DNA-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00249 ) Myb-like DNA-binding domain
  • ( pfam07384 ) Protein of unknown function (DUF1497)
  • ( pfam02706 ) Chain length determinant protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007216002.0004286606204839e-16myb-like DNA-binding domain, S
HAQKYF class fa...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13085.0.g100(coding)
ATGATGGCGAATGATTTAATTATTGATCAGGAGAGAGACAACTCTTCCTCTAATTTATAG
ACCTATGAACCGATTAAACACATCTCAAACCCCTAAGAAGAGAGCTTCGGGGACGAGGAA
CCTAATATGGTAGGAGCTCAATCGAAATCAGATCTTTAAAAGAGAGATGGGTCAGAGGGT
ATACACGGAAGCAGCGACTTCAAACTAGATAATTCTTAGCAATAGGCATCATCAAGTTTA
ATCTAGCTACCAGCCACTAACCAAGCTAGAAAACCTTACTCAAGAGGGAAGGATCGAAAA
TCTCGTAAGGAGAGCGTTGCCTCTAACACTGGGCCAGACGGCAAGAAGAATGGACGTTGG
TCTATGATGGAACACGTTAGATTTTTAGAGGCCCTTAAAAACTATGGAAAGAATTGGAAG
AAAGTAGAAGATTATGTCGCCACAAGGACCAGCACACAGGCAAGATCACATGCCTAGAAA
TTCTTTGCAAATATCATCAAATCAAGCATGACAATGGAAGAGTTTTTAGAGAAAATCTCG
TACGATGCCATCAACCAACTTAGAAGGATTGCGCAAAAAAGTAGTGATAAAATTAAAAAT
GGAGGAGGAGATGAAGATGAGATGAGCGAACCTGAAATTTTGAAACTACTCATGATGCAC
ATGTCAAAAAATCATCATGAAGATGAGCTGGAAGCATTCGGCGACCCTGAATTTAAGAAG
CGTAGCACTGAGGAAAACTTAAGCGAAGATTTTGAAGTTGAGCAAAACCTCAACAGCGAA
AGTATCAATATTCCTGATGTAAAAAGCAGAAAAACTTCATTCGTGAACCCTAACAACAAA
AGGAAAAGATCAGCTAAGATTAAGACCCATAAACTTGAAAAGGAGGTTTTAGAGGAATAC
AAACAAGAGTAAGCCCCTGACACTCAAGTCGCATAAATAATTGAAACTTAGACTTATTAA
GGAGAATAATTTATTCAGTAAATTGAAGAAGAATAATTATCTTCTGATGACTTAATCCTA
GAGTAGTCGGCTAACTATGAGCAAATGAACTTTGGAGCTGCAACTATTAAGGCTCAAAGC
TAAATTGAGATTGATTAGAAATCATTATTTGAACCTAATCACAGTATTGAAAATCGTGAA
AATGAGCTTTTAACCCCTAATGCTACTACTAGGACTAATAGAAGAGTTCAAAAAATAAGT
AGCTAGTTTATTAGTTTCTAGAACGACTTTGAAGGTAATCACTAGTTTGCTTTCAATAGC
AATTTCGAAGAGCTGCATGAAAAAATTAAACCCTAAAGCTTGATTCATGAGGATCACCAT
CATGAACTTAATCTTTCTGCTAGACCTATTGTACCATAACAATCTCATGGCTTAGCCATG
GACTTAAACTTTACTCCTTAGAGCCACTTTAACTCAGTCAATCCTATTCATTTGCCCTTT
TAACACCTCGCAGCTACTAACAATTCAAGCATGATCAAAAACCTTAACTTGATGGGTGAT
AATTTCAGTAGAAGGTAGTCTAGAATTTCCTAAGACCTACTAGCTGGTCCTGGATCTATT
CATAATAACTAGCATCATCTATCTAACAACATAACCAACTTGATGATGGAAAGATCTAGA
GGAGGCTCTTCTTTTGATATCAATGACTGCTTTACTTCTAGAGATCACTAGGGTATAGAT
GACTCAGTTAACCACCACAATGGAAGTGTTTGCAAAAATGCATCCTCTTCTGCTGGTGGC
TTTAACTCAAGCCTCTTCCGTAGGCCAAATCAGCTTCATCACTAACTCCCAGCTTTTCAA
AGCTGA


>Contig13085.0.g100(protein)
MMANDLIIDQERDNSSSNLQTYEPIKHISNPQEESFGDEEPNMVGAQSKSDLQKRDGSEG
IHGSSDFKLDNSQQQASSSLIQLPATNQARKPYSRGKDRKSRKESVASNTGPDGKKNGRW
SMMEHVRFLEALKNYGKNWKKVEDYVATRTSTQARSHAQKFFANIIKSSMTMEEFLEKIS
YDAINQLRRIAQKSSDKIKNGGGDEDEMSEPEILKLLMMHMSKNHHEDELEAFGDPEFKK
RSTEENLSEDFEVEQNLNSESINIPDVKSRKTSFVNPNNKRKRSAKIKTHKLEKEVLEEY
KQEQAPDTQVAQIIETQTYQGEQFIQQIEEEQLSSDDLILEQSANYEQMNFGAATIKAQS
QIEIDQKSLFEPNHSIENRENELLTPNATTRTNRRVQKISSQFISFQNDFEGNHQFAFNS
NFEELHEKIKPQSLIHEDHHHELNLSARPIVPQQSHGLAMDLNFTPQSHFNSVNPIHLPF
QHLAATNNSSMIKNLNLMGDNFSRRQSRISQDLLAGPGSIHNNQHHLSNNITNLMMERSR
GGSSFDINDCFTSRDHQGIDDSVNHHNGSVCKNASSSAGGFNSSLFRRPNQLHHQLPAFQ
S