Identifiers and Description

Gene Model Identifier

Contig18877.0.g87

Standard Name

MYB33

Aliases

Contig18877_0_g87

Description

Myb-like DNA-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00249 ) Myb-like DNA-binding domain
  • ( pfam13921 ) Myb-like DNA-binding domain
  • ( pfam12703 ) Toxin of toxin-antitoxin type 1 system
  • ( pfam01857 ) Retinoblastoma-associated protein B domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007216000.00010003404299092957myb-like DNA-binding domain, S
HAQKYF class fa...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18877.0.g87(coding)
ATGTTTGAGATCAAGATCTCCGCAATTATATAAGGGAAGAGGAAAACTGTAGCTATAAAG
TGCGATGAGGAATATCAAGTTAAGCTCAAAGAGCTTCTAAGCAGAGTAGATTCACATGCA
CTTATCAAAGAGTTGTTGAGCATCGGTCCATAAAACATTGATCAGGTTCTCTTGAGAAAG
CCTCCACAAGTCACTGCACAAAGAATACCTAACCATCATAATAACTCTCATTAATCACAA
TTCAATCAAACAACTAACTCAAGACCTAATGAGAGCCTAGGATTGACAGAGCTGCAAAGA
ATATAGGCTTTGATAAAGAAAGAGACACCCTCGCCTACTTAGAATTCAGCCATCAGTTCT
TTGAACATTTTCAATCAGAGCAATGCCAGGAAAAATGCTGCAATCTTATAAGCATATTAG
GATTCCTTTTTATCCCAACAAAGATAGAGTACAACTAGAGCTGTCCCTGGAGACTTCGAA
TATTAAGTGAGTAGAAACTCTGGCTAACCTAACTTCAGGCAACGAGATTACCCAAACAAG
AGAAATACGACCACATACACAACTGGAAATCAATAACAAAATTACTCAGACGATGATCAT
CCCTCTGGAAGACCCTCATCAACTCCAAGAGGTGACCTTAATTATTAGCAAAATGAGAGT
AAAAACACAATGGAAAATGATGAAAGTAAGCAGTCATACTTCTGGGATGAGAAGGAGTGC
GTGGATTTCATTAAATTAATGCACCTTCACGGCAAGCGCTGGATAGTTTTGAGCCAGCAT
TTATAGGGCAGGAACTAACTTTAGTGCAGAAGTCATGGTTAAAAATACCTCAAAGCCCAT
AGGGAATTGTTGACTATATGCGAAAATATGGTTGACAAAAACATCATGCCTAGTGATTTG
AACTTGCTCAGAATCAAGAGATATGAATAGGATTGCAAAAATGTCCTGGAATCTTTCAGA
AAAGATATGAAAACTGACCCAGAAATTCTAAAGAATATTATGAGGAAGGAATTCTTCCCA
AATTATATGGTGAATCATTACATTTTGGAACACAGACCTCAAATTCACGCTCTTCCTGAT
AAGCTCGAATAAATCCGAGTAGCTGTAGCCAACGAACTTAGTTTCTATGATGATCTTAAA
ACTCTGAAGAAAAGAGTCAGGCGAGGCAGCAGAGATGACAACATGGGTAGTAGCAGATAC
GGGGGCAATGGAGATGAAAACGATGAAGATTTTGGATTATCTGACTTGGATGAAAATGGC
AATCGTAAGTACAAAGAACCAAGATAGCTCACTAAAGAGGGTTTGGAATTAGAGAAGCAA
ATAGGGGAGGCAGTTGGAGCTATAAAAAGAAGAAAAAACAACACTTCCATTAACAATTCT
AGTGGCTAGCCTATGGCATTAGACTAGCAATAGAAATGA


>Contig18877.0.g87(protein)
MFEIKISAIIQGKRKTVAIKCDEEYQVKLKELLSRVDSHALIKELLSIGPQNIDQVLLRK
PPQVTAQRIPNHHNNSHQSQFNQTTNSRPNESLGLTELQRIQALIKKETPSPTQNSAISS
LNIFNQSNARKNAAILQAYQDSFLSQQRQSTTRAVPGDFEYQVSRNSGQPNFRQRDYPNK
RNTTTYTTGNQQQNYSDDDHPSGRPSSTPRGDLNYQQNESKNTMENDESKQSYFWDEKEC
VDFIKLMHLHGKRWIVLSQHLQGRNQLQCRSHGQKYLKAHRELLTICENMVDKNIMPSDL
NLLRIKRYEQDCKNVLESFRKDMKTDPEILKNIMRKEFFPNYMVNHYILEHRPQIHALPD
KLEQIRVAVANELSFYDDLKTLKKRVRRGSRDDNMGSSRYGGNGDENDEDFGLSDLDENG
NRKYKEPRQLTKEGLELEKQIGEAVGAIKRRKNNTSINNSSGQPMALDQQQK