Identifiers and Description

Gene Model Identifier

Contig1994.0.g8

Standard Name

MYB29

Aliases

Contig1994_0_g8

Description

Myb-like DNA-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001617505.001052752541194e-37conserved hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1994.0.g8(coding)
ATGTCATCAAGCATTTCCGCAGCAATCATGGCTGGCAATCAGAACAAGAAAATCGCAGAG
TCGAAGTCACTTTGGAACTATGCGCTCTCCCCCGGCTGGACTCAACAAGAAGTCGAAATC
CTCAAGATCGCACTTATGAAGTTTGGAGTTGGCAGATGGTCAGCAATCAACAAGTCAGGA
GTGCTTCCCACAAAGCAAATTCAGCAGTGCTACTTGCAAACTCAAAGACTTATTGGTCAG
TAGTCGTTGGCAGAGTTTATGGGACTTCACCTGGACATCGATCGCATCGCTGCAGACAAC
AAGTAGAAGAGAGGCATTAGAAAGCAAGGTTTCCTTGTCAATCAAGGGTGTAAGTTGACT
CCAGAGGAGAAAGATGAACTAAGAAAGATAAATTAAGAAAAGTATGGACTGAGTGCAGAG
CATGTGGAAGCTATAAAGCTTCCTGCACCCTGTCATTTGGTTGAAATCTTCTAGATTGAT
AAGATTATGCATCCTAGGTCAACACTCAGTACTATGGATAAGATCAAGCACTTAATCAAA
CTTGAAGATGCTCTGAAAAGCAAACTTGAAATGATCAGAGAAGGCAAGAGATAGCAGAAG
TTTGAGTAGTTGTAACAAAAGTTGAAAACTACAGAAGCTAGTGGAAGAGGTTCTGTGACC
AGAGTTCAAAGGCAAATGAGTGATTTGCATCTTGGAAGTTCCCACTAGAACAGAAATTCT
GATTTGGATGAAGAAAACGATGAGTCAGTCATGATTATCGATGAGTCTCAACAAGAGAAT
TTAACTCCAAAAGGTAAAGCTTAGGCCATGCTTACTCATCAAAAGTATAATGAAGTAACT
TAAACTATGATAAAGCAAGGAGACGATAGTAGATAGTAGCAGCACCTACCTTTGGATTCA
ACAAGTGCCAGTGTTTCTAACCCATCTTCAACTTCAAAGAGCAGCACTATGAAGAGCAAC
TCAATGAAGTAATCTGAGACAGCAATTGCTTCTATGAAACCATCATCCATTGGCAAGAAA
ACTAAAGTCGACTCAAGTTTTGTGACCAAACAATCGAATTAGTAATCCACAGCTCCTATT
CAGAAGTAAGCTCACTAGCAAAATCTTGACAGAAATAGATCGGAACTAGGTAGTACTTTT
GCTTAATAGGCTAGTGTAGACACATAAAACTCAAACAATTAGGGCACTAGTACAGCTTCT
GGGAACTTCATCTCTCAAAGTGATGATGAGGAAGCTTTGATGCCTAAACTCAAGAGAAGA
AGAGTTGAAGATTCTGAGTGA


>Contig1994.0.g8(protein)
MSSSISAAIMAGNQNKKIAESKSLWNYALSPGWTQQEVEILKIALMKFGVGRWSAINKSG
VLPTKQIQQCYLQTQRLIGQQSLAEFMGLHLDIDRIAADNKQKRGIRKQGFLVNQGCKLT
PEEKDELRKINQEKYGLSAEHVEAIKLPAPCHLVEIFQIDKIMHPRSTLSTMDKIKHLIK
LEDALKSKLEMIREGKRQQKFEQLQQKLKTTEASGRGSVTRVQRQMSDLHLGSSHQNRNS
DLDEENDESVMIIDESQQENLTPKGKAQAMLTHQKYNEVTQTMIKQGDDSRQQQHLPLDS
TSASVSNPSSTSKSSTMKSNSMKQSETAIASMKPSSIGKKTKVDSSFVTKQSNQQSTAPI
QKQAHQQNLDRNRSELGSTFAQQASVDTQNSNNQGTSTASGNFISQSDDEEALMPKLKRR
RVEDSE