Identifiers and Description

Gene Model Identifier

Contig12535.0.g26

Standard Name

MYB28

Aliases

Contig12535_0_g26

Description

Myb-like DNA-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001617502.000704504372864e-47conserved hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12535.0.g26(coding)
ATGTCATCAAGCATTTCCGCAGCAATCATAGCTGGCAATCAGAACAAGAAAATCGCTGAG
TCGAAGTCACTTTGGAACTATGCGCTGTCCCCCGGTTGGACTCAACAAGAAGTCGAAATC
CTCAAGATCGCACTAATGAAATTTGGAGTTGGCAGATGGAAGACTATTGAGTAGAGTTAA
TGCTTACCCACCAAGACCATGTCTCAGATGTATTTGCAAACTCAAAGACTGGTTGGTTAG
CAATCTTTAGCTGAGTTTATGGGTCTCCACCTTGATTTGGAGCAGATTTTCATCAAGAAC
GCTGAAAGGTAGGGAGCAGGGGTTTTCAGAAAGAATGGATGCATCATAAATACTGGTGAT
AACATGACCAAAGTTCAGATTGCTAAGTTGCGCAAAAAGAACTCAAAAATCTTTGGACTT
ACTTAGCCATTCGTTCAATCCCTACATCTTCCCAAAGCAAAAGTGAAGGAATGGTTGAAA
GTACTAACCCTCGACTAGATTCTTTCTGCTAAGAGTAACTTTTCAACTGCTGAGAAGATT
CACTATCTCAAGATTTTGGAGAACGCTTTAGAGAGGAAACTCAAAAAGATCTTAAGGTTG
TAGGAACTGGTAAGCATCTATAGACCATGCAACATCGGTATTGTTGTCTAGAAGAGACTT
GGCTCAAGCATTGGTGATGAGTACTTTGAGTATGTTGATTGTGTAAAGATTGAAGAAAAG
TCTGTAGGGAATTTAGATTTTGCACTTCCAAATAGAAACACCGATTCAACTTCTCTTAAT
GAAGATTTTTCTTTTCTTGACAGTACCCAGAAACCCTAAAAACTTAAAGCTGGCAGTGGT
AGAGAGAACAAGAGAAAGAAGATGAGAGATGGGTTGAAAGATGAGAGAGCTTAGAGACAA
AGCTTGATGGAAGCACTTGATGAGCAAGAATTTGATGAGACTAAGTTTTAAGATTCTGAT
GGAGAGATGCCAGATTTGAACATGTGA


>Contig12535.0.g26(protein)
MSSSISAAIIAGNQNKKIAESKSLWNYALSPGWTQQEVEILKIALMKFGVGRWKTIEQSQ
CLPTKTMSQMYLQTQRLVGQQSLAEFMGLHLDLEQIFIKNAERQGAGVFRKNGCIINTGD
NMTKVQIAKLRKKNSKIFGLTQPFVQSLHLPKAKVKEWLKVLTLDQILSAKSNFSTAEKI
HYLKILENALERKLKKILRLQELVSIYRPCNIGIVVQKRLGSSIGDEYFEYVDCVKIEEK
SVGNLDFALPNRNTDSTSLNEDFSFLDSTQKPQKLKAGSGRENKRKKMRDGLKDERAQRQ
SLMEALDEQEFDETKFQDSDGEMPDLNM