Identifiers and Description

Gene Model Identifier

Contig7279.0.g41

Standard Name

MYB27

Aliases

Contig7279_0_g41

Description

Myb-like DNA-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001617503.0009061039838537e-46conserved hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7279.0.g41(coding)
ATGAGCGTACATCACAAAATGGCCGACTCCAAGAGTCTTCATAATTACACTCTCTCACCA
GGCTGGACCAGAGAAGAGGTCGATATCTTGAAGATAGCCTTGATGAAGTTCGGTATTGGC
AAATGGAAAAAGATTTAAAAATCTGGATGTTTACCATCAAAGACCATTTCATAAATGAAT
TTACAAACTCAAAGACTTTTAGGTTAACAATCTCTTGCTGAGTTTATGGGCTTGCATGTA
TACTTAGATAGAGTATTTAGAGATAACTCCCTAAAAACTGGCCCTGAGATCCAAAGAAAG
AACAACTTCATTATCAACACAGGCAACAACTTGACTCAGCCAGAGAAAGAAAAGCGTCTC
CGCTTGAACAAGCAAAAATACGGCCTTGATCTAGCTTTTATCAAGACTCTGAGACTCCCA
AAGCCAGAGAGCGCCACTGGAGGCAAGAGAGAAGCCATTCTATCTATGGATTAGATCTTT
GCACAGAAGAGTCATTTCACAGTGGTTGAGAAGCTAAAACACTTAGAAGCACTCAAAAAC
GCACTGTGTAGCAAACTAGGGAAGATTGAGAGGAGAAGAAGAAATAAAGAGCTCAGCAAG
ATATACAGACCACTTGGTTAACTAATTGTGGTCCAAAAGAATGCAGATGATCAATATGAA
TTCGTTGATATCATCGATGAAAATGAATGA


>Contig7279.0.g41(protein)
MSVHHKMADSKSLHNYTLSPGWTREEVDILKIALMKFGIGKWKKIQKSGCLPSKTISQMN
LQTQRLLGQQSLAEFMGLHVYLDRVFRDNSLKTGPEIQRKNNFIINTGNNLTQPEKEKRL
RLNKQKYGLDLAFIKTLRLPKPESATGGKREAILSMDQIFAQKSHFTVVEKLKHLEALKN
ALCSKLGKIERRRRNKELSKIYRPLGQLIVVQKNADDQYEFVDIIDENE