Identifiers and Description

Gene Model Identifier

Contig20880.0.g64

Standard Name

MYB26

Aliases

Contig20880_0_g64

Description

Myb-like DNA-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam13921 ) Myb-like DNA-binding domain
  • ( pfam00249 ) Myb-like DNA-binding domain
  • ( pfam11539 ) Protein of unknown function (DUF3228)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001617503.998479955315009e-46conserved hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20880.0.g64(coding)
ATGAGCGTACATCACAAAATGGCCGACTCCAAGAGTCTTCATAATTACACTCTCTCACCA
GGCTGGACCAGAGAAGAGGTCGATATCTTGAAGATAGCCTTGATGAAGTTCGGTATTGGC
AAATGGAAAAAGATTTAAAAATCTGGATGTTTACCATCAAAGACCATCTCATAAATGAAT
TTACAAACTCAAAGACTTTTAGGTTAACAATCTCTTGCTGAGTTTATGGGATTGCATGTG
TACTTAGATAGAGTATTTAGAGATAACTCCCTAAAAACTGGCCCTGAGATCCAAAGAAAA
AACAACTTCATCATTAACACAGGCAACAACTTGACTCAGCCCGAGAAAGAAAAGCGTCTC
CGCTTAAACAAGCAGAAATACGGCCTCGATCTAGCTTTCATCAAGACTTTGAGACTCCCA
AAGCCAGAGAGTGCCACCGGAGGCAAGAGAGAAGCCATTCTATCTATGGATTAGATTTTT
GCACAGAAAAGTCATTTCACAGTGGTTGAGAAGCTAAAGCACTTAGAGGCACTTAAGAAT
GCTTTATGTAGCAAACTAGGGAAGATTGAGAGGAGAAGAAGAAATAAAGAGCTCAGCAAG
ATATACAGACCACTCTGTTAATTAATTGTTGTCCAAAAGAATGCAGATGATTAATATGAA
TTCGTTGACATCATCGATGAAAATGAATGA


>Contig20880.0.g64(protein)
MSVHHKMADSKSLHNYTLSPGWTREEVDILKIALMKFGIGKWKKIQKSGCLPSKTISQMN
LQTQRLLGQQSLAEFMGLHVYLDRVFRDNSLKTGPEIQRKNNFIINTGNNLTQPEKEKRL
RLNKQKYGLDLAFIKTLRLPKPESATGGKREAILSMDQIFAQKSHFTVVEKLKHLEALKN
ALCSKLGKIERRRRNKELSKIYRPLCQLIVVQKNADDQYEFVDIIDENE