Identifiers and Description

Gene Model Identifier

Contig11479.0.g73

Standard Name

MYB24

Aliases

Contig11479_0_g73

Description

Aminotransferase class-V

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004182903.000745802558524e-63aminotransferase, class V fami
ly protein
SGDYOR184W3.9982663658145016e-63SER1 SGDID:S000005710, Chr XV
from 679357-680544, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11479.0.g73(coding)
ATGGAGGTATCAGAAGCTTCAGAGATATTCAATTTCTCCCCAGGTCCAGCTTGTCTACCA
AAGGAAGTACTGAAATAAGTTCAAGACGAATTCATGTCTTACAAAGGATATGGCTTTAGT
ATAGTTGAGATGGCTTCAAGAACCCCAGAGTACTATGATATGATTGAAGAAGCAAACAAA
GGACTGAGGGATCTTCTTAACATTCCTGAGAACTATCTTTTGCTATGGTGTCAAGGTGGC
GCTTATTAGCAATTCACCGCAGTGCCATTCAATCTTGGTCAAAGCTAAGAAGCATCCTAC
TTGGTCTCAGGTTTTTGGAGTGAGGAATCAGCCAAAGAGGCTTCTAAGTTCTTAGGCAAC
GTTCATTAAGCTTGGACTCCAACTGAAGAACAGAAGTTTGTTAGTCTACCACAACAAGAA
GATATCTCTGTCTCAAAGGATTCGAAGTATCTCTATTATTGTGACAACGAAACTATACAT
GGAGTGGAATTTGCTTAACCAATAAGAAAAGATGAAAGATAAGTACCAATTGTCTGTGAT
TTCACTTCCAACTTTGCATCAAGAAGAATTGATTGGGATAACATGGATGTTGCATTCGCT
GGAGTGCAAAAGAATTTGGGACCCTCTGGGTTATGCTCAGTGATTATTAATTAGGACTTG
ATTGGCAATAAGAGAAAAGATACTCCTATTCTCTGCGATTGGGAACTACATAAGAATTCA
CCAAATAACTTTTACAATACTCCTAATGTATTCGCACTCTATTTGACTAACTTGGTTATC
TAGCATACCAAGAGATTAGGTGTTGATTACTATGACGATCTAGCCAAATAGAGATCTAGT
TTGATCTATGATCTTATTGACAATTCAAATGGCTTCTATACAAGCAAGGTAGACCCTAAA
TCTAGAAGCAGAATGAATGTTTCTTTCCATCTCAAGTCAAAGGAAGAGGACCAAAGATTC
GCTAAATTGGCAAAGGAAGAAGGTCTTTTGTGGTTAGCTGGTCATGCTAAATTTGGAGGT
TGCAGAGCTTCTATGTATAACGCTATGCCAATTGAAGGTGCCATTAAGCTTCAACAATTC
ATGAAAAAGTTCCAAGATGAAACTGAAAGACTCTGA


>Contig11479.0.g73(protein)
MEVSEASEIFNFSPGPACLPKEVLKQVQDEFMSYKGYGFSIVEMASRTPEYYDMIEEANK
GLRDLLNIPENYLLLWCQGGAYQQFTAVPFNLGQSQEASYLVSGFWSEESAKEASKFLGN
VHQAWTPTEEQKFVSLPQQEDISVSKDSKYLYYCDNETIHGVEFAQPIRKDERQVPIVCD
FTSNFASRRIDWDNMDVAFAGVQKNLGPSGLCSVIINQDLIGNKRKDTPILCDWELHKNS
PNNFYNTPNVFALYLTNLVIQHTKRLGVDYYDDLAKQRSSLIYDLIDNSNGFYTSKVDPK
SRSRMNVSFHLKSKEEDQRFAKLAKEEGLLWLAGHAKFGGCRASMYNAMPIEGAIKLQQF
MKKFQDETERL