Identifiers and Description

Gene Model Identifier

Contig22653.0.g27

Standard Name

MYB23

Aliases

Contig22653_0_g27

Description

DIRP

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005915605.999781043483669e-32DIRP family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22653.0.g27(coding)
ATGGCTGACACTCATCCGACTCTCTTCTAAGGCCCTAGTGCCTTCCAACCTCGAAGAAGC
AACGATTTTGAGCGCAATGAAGCGGTTTCTGTTGATAAAAATGTTCAGAACAAGTTTGAC
TTGGGACCCAGATGGAGTAGTGAAGAAATTCAACTGTTCTTTGAAACGTTCCGAGATTGC
GGTAAAGACTGGGAAAGTATTCTAAATGAGCTTCACACGCAGGGATTCACCCACAGAACC
AAAGATCACATAAAGTCTCTCTACTCAAAGCACAAAACATATTTAAAGCTGGCAACTGCA
TCCGCCCAAGATCTCACAGCTATTATGACGGACTACTACAAAAGTCTTAATCTAGAGAAA
TAGCGTTAAAATCAACTGAAGCAAAACATTCAGTTATAGCATCAGCAACACTCGCTGGAC
AGCTCTGGCGGACCTAATGGGCCAAAAGGAGATGAATTTGCTTGTGATGAGAACATAAAG
TCGATTAAAATTCCTAGAAGGCCGAGCGGTGGTATGGTGGTGAGACCAGGATACTCTAGT
AGCAGCGAAGAGGTCTAAAATAAAAATAGCTAAACTTCCAGTGATGATCAATACCAAGAA
AATACTTAAACCAGATTCTAAAAAGGCTTTTAGCAACATCAGTAACCATTAAATAGAGGG
CCTTCAGGGGTATTCAGACCTTAAATAATCAAATAATAAGAGGAAGGTAGTGCATTTTAA
AGGTACAACAGTGGTAGTGGAAACACTATGAATGTTTTTCAAGGAAATAATTAGACTGGA
TTTAAGAACTAAGCTTAATAACAATAATAACAATAGCAGTAATAATAAAATTAGGTGCAT
TAGTAATAGTAGAATCAGAACTATGATGATACAGCTTCTGACAGAGCAAAAGGCAAATCT
TTCAACAGAAATGAGTAATATGGCAGCCGCAGTGCTCAAAATCAGCATAAATACAAAAGC
AGGCAGTAACACTATCACTAATTTTACCCCAAAGGTTAGAGAAATGAAAGATATCCCCTA
TAAAATGCTTCAAATTAAAATCAAGAAATGTATGATGACAATATTCAAGAAGGCGGCTAA
TATATCTATGATGATTAGCAAGAAATGGACACACATTAGTAATAGCATGTGACCCCTTCC
AGATAGAGAAAAAGAACCTTATACCCTGGCGGCATGCCTTCAAGAAGACTTTTTTCTTAA
AACACAAGTCCAATGAGAGGCGCAGGTTAGAGCTAAGTTGGAAACAGTTATGGTAGAGGA
GTTCTTGGGCCATTTAAAGGGTAATAAAACTTAAAAAATGGTGACAAAAAAGATGCAAAA
CCAAGATTGACTACTCAATAAAAGAGACAAATAAAATCAAGCAAGTAGATCTGCAGGAGA
GGCCTTTAAGAAATGAATCCATTCTTTATGATACAAGATGACTCAGATCAAGGGTAAAAT
GTCAAGCAAAATGTGCCTCCATAGTCTCCAGTGAAATATTCTAAAGCTGTAATGAGATGG
ATGAAATGTGAGTATTTTTACTCTTGGATTGATAGGCCATACTTTTTGAATAGCGACTTT
AAACAGTTGCTTGCAAAAGCTGATTTAGAAAATGTTAAGCTTAACTCTCTTGAATGGTCT
ATAGTAAGAATAGCGATAGCTGGAGCTACTGGGAAACCAAGAAGATTCTCAGACTAATTT
ATTAGTGATGAAAAATAAAAACTTAACATTTACAGAGAAATTTTCCGCGAAATTATTAAG
GCCATGTAGTAGAAGAATTTTATTCCAGATTAAAATGGAGATCTACAAATGTTCCACTAT
GACAAGAAGCCGCAATTTGAAGAAGAAAAAGTTAAGGAGGTTGTATAACTTATCCGAGAC
TATCAAATTGCTCCCCTAGTTGTAAGTTAAAGAGTTTTGGCACTTCATCCAAAGACTAAA
GAATTAAGAACTGCATCTCTCTTGACTACAGATGTAAAATCATATCATGCTCAGTTTGAT
AGACCTGAACTAGGAGTCATAGTTATAAATGATCTGTAATTAATACCAATATCTGGAAAC
GAATACTATCAGTAGAATCAAAATTAAAACAGCAATATGCACTTGAACAAGCTTAGAAAC
CTTTACCTATACAACAAATTCTAAAACATGATTTAGAGAGTACATGAAAATAATTAAGGT
CAAATTGTTACAAATTAAAATCTACAAAACCCATTTTCTATGCAAAATAATCTGTCTCTT
GATGAAGAAGAAGGAAATTTTATACCATTTGATCATACTCAATTTTCCAAAGATAATATT
CGAGCAATGGCGCTTTTAATTATTCTTTTTGAAAGAAAGAACCGATTGATTTCAGAGATA
AAGTTCTTGAACGATTAGTATGCCAGAAACCCTCAATACACTGAAGACTTTAGATAAAAA
TACGCTTGGACAGCAGTTTAGCTTTAAGCTACCAACTCCATAGTTGAGCCAGTGCTCACA
ATGTTTAGGTACAGACAAATAAAGCCTGAATATCTTTCTTTATATGAAAATGATGGGAGA
TTTGCAGCAGCAATCAATGGCACTATAGATCCTAAAGAGTAGGAACTATTGCTCAAAATA
CACTCTTGTGAGAAAGGCGAGGAACTTATAAATGTTGAATACTTCAAGCGCGCTTAAACT
CTATAAGAAATCGATGAGTATATCGAGATCAAGAAAGACTATAGTAACAGCTGTCAAGTA
TTTGATAATGAAGTTTATCAAGGAATTGACAACATTGACGATGAGGATTCAGAGATGCAA
GATGACCTTGAAATTAAACAAGAGACTTCTAAAGAAATTGATTATGACAGTCCCCCTAAC
ACTGCAATGATAGCTCAAGAAATCGCCTCTTCGATTTTGACACTTTAACAGTACTACAAA
ATTATGATGCCAGCTCATTTACCAGAAGAAAGCAAACTCTATCAAGATGAACTTTCAAAG
CAAAAGACCTCCTTATAGAATAACGAGCAATCTTAAGAAAAGGATTAACATGACTAATAA
CCTCAATATTTCTCATTGCCCTAACAATTGAAAGCCAATATCTCAGCACTTGAAACTATA
ATCTAAAAATGCACTCACTTGAACGACGAGCAGTTGAAAGGGAACCTTGACACTATTACA
GATTATGTAAACTCAGATGAAATTCAAGATACTGAGTAAAATATCAATCAAATATAAATC
AATCAAAATAGAGTGCTGCTCAAATAAATATAGAATGAATTGTATATTCTTCAATAGAAG
TTGTAATCTAGAGTGCTCAATCAAATCCATGAACAAGACAAATGA


>Contig22653.0.g27(protein)
MADTHPTLFQGPSAFQPRRSNDFERNEAVSVDKNVQNKFDLGPRWSSEEIQLFFETFRDC
GKDWESILNELHTQGFTHRTKDHIKSLYSKHKTYLKLATASAQDLTAIMTDYYKSLNLEK
QRQNQLKQNIQLQHQQHSLDSSGGPNGPKGDEFACDENIKSIKIPRRPSGGMVVRPGYSS
SSEEVQNKNSQTSSDDQYQENTQTRFQKGFQQHQQPLNRGPSGVFRPQIIKQQEEGSAFQ
RYNSGSGNTMNVFQGNNQTGFKNQAQQQQQQQQQQQNQVHQQQQNQNYDDTASDRAKGKS
FNRNEQYGSRSAQNQHKYKSRQQHYHQFYPKGQRNERYPLQNASNQNQEMYDDNIQEGGQ
YIYDDQQEMDTHQQQHVTPSRQRKRTLYPGGMPSRRLFSQNTSPMRGAGQSQVGNSYGRG
VLGPFKGQQNLKNGDKKDAKPRLTTQQKRQIKSSKQICRRGLQEMNPFFMIQDDSDQGQN
VKQNVPPQSPVKYSKAVMRWMKCEYFYSWIDRPYFLNSDFKQLLAKADLENVKLNSLEWS
IVRIAIAGATGKPRRFSDQFISDEKQKLNIYREIFREIIKAMQQKNFIPDQNGDLQMFHY
DKKPQFEEEKVKEVVQLIRDYQIAPLVVSQRVLALHPKTKELRTASLLTTDVKSYHAQFD
RPELGVIVINDLQLIPISGNEYYQQNQNQNSNMHLNKLRNLYLYNKFQNMIQRVHENNQG
QIVTNQNLQNPFSMQNNLSLDEEEGNFIPFDHTQFSKDNIRAMALLIILFERKNRLISEI
KFLNDQYARNPQYTEDFRQKYAWTAVQLQATNSIVEPVLTMFRYRQIKPEYLSLYENDGR
FAAAINGTIDPKEQELLLKIHSCEKGEELINVEYFKRAQTLQEIDEYIEIKKDYSNSCQV
FDNEVYQGIDNIDDEDSEMQDDLEIKQETSKEIDYDSPPNTAMIAQEIASSILTLQQYYK
IMMPAHLPEESKLYQDELSKQKTSLQNNEQSQEKDQHDQQPQYFSLPQQLKANISALETI
IQKCTHLNDEQLKGNLDTITDYVNSDEIQDTEQNINQIQINQNRVLLKQIQNELYILQQK
LQSRVLNQIHEQDK