Identifiers and Description

Gene Model Identifier

Contig10492.0.g70

Standard Name

MYB22

Aliases

Contig10492_0_g70

Description

Myb-like DNA-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004607400.000000000000005001692698841201Myb-like DNA-binding domain co
ntaining protein
SGDYNL039W0.0000000020002373268528243BDP1 SGDID:S000004984, Chr XIV
from 555048-556832, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10492.0.g70(coding)
ATGACTCCTACTACAAAGAGAGCAGCAGCCACTAAAGTTAACAAAAAACTAATGAATAAA
AAATAAGTCAAGGTTTAACCTAAAAAAGTGAGTATCAAAAGCAAACATAAACTATCTAAA
TCAGCTCCTCTTAAATAGAAGAAAAAGCATATTGAGGAAGCTAAACATGAAATATTGGGC
AAGAGAGCAAGGAAACCACTTAAAACTGAGGGAGAATTTGAAGCAATAATTGAGAAGAAG
GACAAAGTAATTAAAGGAGCAAAGCTTAATGGCGTATTAAGGAGTAGCTCAAGAAATGGA
AAACAATAAACACAAAATACAAAGAGTGAACCAATTCCTAAGATTCAAGTTAACAAGAGA
ACTTAGAAATAGCAAAGCAAAGAAGAGGTAAAAACATCTAAAGTACAAGAGAATGGCTTA
AATTAGAGTGAACCAAGAAGGAGATTATAGAGAAATGCTAGTGTCAAAGATGAAGAAGAG
ATTAAATCAGTACAAGTTCAAAAATAGAAGAATAAGCAAAACGTTAAGGAAAGTAAGGAC
ATCAAGAGAGAAGCTCTAGTTAAACATGAGAAAGAATCAACTGCAATTAAGAATGAAGAC
ACAGATAAAAAGTCTGATGTAGCTAAATTAGTAAAGTAGGAAAAGAAAGAGCAAATTGCA
TTGGTCAAAAGAAGAAAGTCATCTGATAGGGGAAGCAGAGCTTTAGTTGGTATCAACACT
CAGCAAAACTTAGTAATTCAAAAAACTTCTGGAGAAAAGACACTGATTGAAATTATTGAA
GATAGTAGATCTGGTATTCCTGCAAAGAGTGAACTAGAATCAAAAGAATAAAAAGCCTTC
TTGAAGAAACAAAAACTTGAAATGAAAGATGAAGAGGGAGAAAGCAAAAATTCAAGTGCT
CAACCTAAAACCTTTTTAATGAATGATTAACCAAAGAAAGCACAATCAGTTGCCAGTCAA
AATGAGTCAGCTCAAAAGTCTTTGAATTAATCAGCAGCTCAAGCTTCAATAATATCAAGA
CCAAAAATTATAATTATTAATGGCAAACCCTAAATCTAAGCTCCACTTTTGAACTTCTAA
CAACAGAGAGAAAACGCAATTGCACTTGCAAATGAAAACAGAGAAATTACAGTTGTAAAC
TCAAGCAATAACAAACTTTCCTCTTTAAGTTTTATGAAGAGACAACCAGCTGAAAAATGG
AAACCAGAAGAGACTAAAAAGTTCTATATGGCTCTTCAAATATTTGGCACTGATTTTAGC
TTGATAGAGAAAGTATTCAATTAGGAGAGATCCAGAGAGTAGATTAAGAATAAATTCAGA
AAGGAAGAGAGAAAGAACAAGAAATTCATTGATGATTTGCTTAACAATAAAGAAAGAATA
AACCTGAAAGATTTTGAGGAATAATTTGGTAAGACTGACTTGGGAATCGGAGATGATTTC
GTAGATGAGGCAGAGGATCTTTTGAAATCAGATGACGAGAGCAGTGACGATAGCAGCAAT
AGTGATGACAGCGAAAACGACAGTGAAGAGAAAACCCCAAACAACGAAGGTTCTGCCACG
AATCAAAGCCAATCAATAGATCCTTCTAAAAGCAATCTCCTTTAAAAAACAGTGGGTAGT
TTCATTAACAAATTCAACATGCAAAACAACAGTGCAATCAAGCTTGAGGCCGGTTCAGAA
AGTGACTCAAGATTTGGATCTGATTTCAAAGCAAATATTTTATCAAATAATAGACAACTA
ATCGAAGGCAAGCAAACAGCCTCATCAAGTGGTTTCAGCCCTTTCAAGATGTTGCAGCAA
TCTAATATTTCTAATTAGATCTAAGGTGCTTCAAAAAGCGCTTTTTAAAAGCCAGGTATG
TTACAGAACTCTTAAAGCCAAAACAAATCTGCTGCTCCTCTTCAACAATCATAATAAACT
ATAAATAATAGCCAGAAAAGTTAGAGTACTAGTATCTAAAACTTTAAGATTAATACCTTT
TGA


>Contig10492.0.g70(protein)
MTPTTKRAAATKVNKKLMNKKQVKVQPKKVSIKSKHKLSKSAPLKQKKKHIEEAKHEILG
KRARKPLKTEGEFEAIIEKKDKVIKGAKLNGVLRSSSRNGKQQTQNTKSEPIPKIQVNKR
TQKQQSKEEVKTSKVQENGLNQSEPRRRLQRNASVKDEEEIKSVQVQKQKNKQNVKESKD
IKREALVKHEKESTAIKNEDTDKKSDVAKLVKQEKKEQIALVKRRKSSDRGSRALVGINT
QQNLVIQKTSGEKTLIEIIEDSRSGIPAKSELESKEQKAFLKKQKLEMKDEEGESKNSSA
QPKTFLMNDQPKKAQSVASQNESAQKSLNQSAAQASIISRPKIIIINGKPQIQAPLLNFQ
QQRENAIALANENREITVVNSSNNKLSSLSFMKRQPAEKWKPEETKKFYMALQIFGTDFS
LIEKVFNQERSREQIKNKFRKEERKNKKFIDDLLNNKERINLKDFEEQFGKTDLGIGDDF
VDEAEDLLKSDDESSDDSSNSDDSENDSEEKTPNNEGSATNQSQSIDPSKSNLLQKTVGS
FINKFNMQNNSAIKLEAGSESDSRFGSDFKANILSNNRQLIEGKQTASSSGFSPFKMLQQ
SNISNQIQGASKSAFQKPGMLQNSQSQNKSAAPLQQSQQTINNSQKSQSTSIQNFKINTF