Identifiers and Description

Gene Model Identifier

Contig16326.0.g54

Standard Name

MYB20

Aliases

Contig16326_0_g54

Description

Myb-like DNA-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010099704.0009493637353324e-18myb-like DNA-binding domain, S
HAQKYF class fa...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16326.0.g54(coding)
ATGCAGGCTTAAACATATACTTCAGAATAAACACTTGGTTTTCTTTCAAAACCGCAAATG
GTAAACAGCGGTAGCACCTTGAACTCTACACCCGACGATGTTGTGATGGACTCTCAAATG
GATTTAACTCAGGAAATTATCTAAAAAGAACTTGCCGCATCTGTCGATTCATTGCACTTA
AATGATTGCTTTGATGGCCATTAATCACCCAATAAATAATAACTAGTATTACATAATAGT
AAAGTTAAAAATCATAACTCCTCTGATTTCTATAATTAAGATACTTCAATGATGATGCAT
TCTAATGACATGAAGATGCTTTCAGAGAGTCACAAACGAGAGCTAGGGGAAGAGGAAGAT
GAATTCGAATTACATATTTATGACAGTAAAAGAGAAATTCAATCTATGGGACGGTCATCA
CCCGATTTCAATCAACACACTTCACTAAACTAGAAGGAAGACAGGAAGAGCCAGAATTCA
ACAGAAAAAAGGAAGCTAGCATTAAGCGGACAAAGTGGTAGTGCAGATTATATTCATGAA
AATCAGATGAGTTTAGAATGGGACACTAAAGACCCAAGGGATGCAAGTCTGGACAGCTCA
GATGAGGGAAATCAAAATGACGACAAAGATGACAGCAGTAACACTAAAGATGATAATAAA
AACGCAGGGCGTTGGACTGATGAGGAACACGCTAAATTTTTAGTGGCGCTTTAACTATTC
GGGAAAAATTGGAATAAAGTACACAAGCACGTAGGAACTCGAAGCAGCGCCTAAACTAGG
TCACATGCCTAAAAGTATTTTAATAAGTTGATGAGACGAGGAACAAAGGAGGCAACAGAA
GAATTGCAGTTGTTGACTAGAAAGGACTCGCTTCTAAAGACCAGCATAGATGAGTCAACT
ATGGATGGGAGCGCAAATTAGAACAGTTCAAGTATTAATGGCGGTGCAGGAGCAAATTAA
AATAGCTATTAAGTATCACCTTCATCCAAAAATAGTCCTCTACCTCGAGTACTCTGTAGT
GAAGATTTGAACATAAAAGTAAACCTTAGGCCTAATTCATACCCTTCACCCATATTAAGC
CAGCCACCCTAAATTGTCCATAATGGATAAACAGTAGATGAAGATATATTAGACGAAGAC
GAGGATGCTGATCAAGTTTAGGATGATGATTCTCTAGGCTCCAATGACCTAAGATTAAAT
AAGCAAAAGTCTAAAAAGATTAAAAAGTGTAGCAATAATCTTTCTAAGTCTCCTAAAATA
ACTCACTCTTCTACAAGCTTTTCTATCTTGAATAATCCAAAAGAATTATTCAAGGATAGT
AAGAAGCAAAAGATTTAGGCATCTCTGAAGTTCAGAAAAGATTCAATTTTGTCTGAAAAG
CGCAAAGAACGCTCTTATTCTAAGTTATTCGAAGTAGTTAAGTGTTAATAGGCTCTTGAA
AACTCTCAAAACTTGAACTAAAGCTCTAGAATAGAACAAAATGACAACTCTTAGAATAAT
GATAACTCAGCTTAATCTCAAACTTAAAACATGGCATCTCTTGAATGCAAAAACAATAAC
ACTCATGATTCTAACACTAATGCTATGAATGACTATTAAATCGAGGATGAGGTTGACACT
TTTTAAAGCAATAACTTGCAACACTAAGAAATAGAGTATCCACCTCAACTTAACCCCTAA
ATCAATCCATACTTCTTAGCTTAATAGTTCAACAATTATCATTTAGATACTTAAACGAAT
TACAATTAGGACAACATTAATGAAAACAATCATATGATTAGTGATAGTACTCATCCAATT
CCTGTTCAACAGATTTAACCATAATAATTTTAGCTTCAGCAACCATTCCAGATGAGCCAT
CATAATCCATATAACATCCCATAAAATTTCAACAATATTATTTAACACTAAAATATAAAT
TAGATGACCTTTGCAAATAATAGCGACAAAGAAATTGACATGAATATCAGTGTTTAAAAT
TAAAAAATTCAATCTACTGAAGAACTTTTAGATTCCAAAACCCTTAGAATGAGAAGTCAA
AGTACAATGATTCCAAACTAGTTCAGTCAAAATGGCGTATACCAATTCTAACCTCATAAC
TAACAGCTTGGTGGATTCCAGCACTGCTAAGATGGGTTCTTCACAACTATGAACAATGAC
GCTCTAGATAAATTTGAAGTGCCCTTTGTTGACCTATCTAATTCGAATCCATTGAATGAC
ACTGGAAATCCATCACTTTACAGTAATAATCTACCTCAAATGATGAACAACAGCTATTTA
TTAAATTAATAGCTGCATCAACAGTAATTTGCAAACCATTACAGGCCAAACTTTAATAAC
AATGGGCATCCTTAAGTTTCTAATTTTGATACAAATTATCAACATCATGTTATGAGGTCA
GTTAGTGATGTGGGCATCTATCACAAATTCTAAAACCAAGCCTAATTGCAAGGCAACAAC
TATCAAGAAGATTTCTTCGATATAGACAACCCTATAATCTCGCACAGAGACAATATTTTA
CTGGATAGATGCATGTCTCCAGCAGCTTCCCTGCACTTGAATGAGTTCTGA


>Contig16326.0.g54(protein)
MQAQTYTSEQTLGFLSKPQMVNSGSTLNSTPDDVVMDSQMDLTQEIIQKELAASVDSLHL
NDCFDGHQSPNKQQLVLHNSKVKNHNSSDFYNQDTSMMMHSNDMKMLSESHKRELGEEED
EFELHIYDSKREIQSMGRSSPDFNQHTSLNQKEDRKSQNSTEKRKLALSGQSGSADYIHE
NQMSLEWDTKDPRDASLDSSDEGNQNDDKDDSSNTKDDNKNAGRWTDEEHAKFLVALQLF
GKNWNKVHKHVGTRSSAQTRSHAQKYFNKLMRRGTKEATEELQLLTRKDSLLKTSIDEST
MDGSANQNSSSINGGAGANQNSYQVSPSSKNSPLPRVLCSEDLNIKVNLRPNSYPSPILS
QPPQIVHNGQTVDEDILDEDEDADQVQDDDSLGSNDLRLNKQKSKKIKKCSNNLSKSPKI
THSSTSFSILNNPKELFKDSKKQKIQASLKFRKDSILSEKRKERSYSKLFEVVKCQQALE
NSQNLNQSSRIEQNDNSQNNDNSAQSQTQNMASLECKNNNTHDSNTNAMNDYQIEDEVDT
FQSNNLQHQEIEYPPQLNPQINPYFLAQQFNNYHLDTQTNYNQDNINENNHMISDSTHPI
PVQQIQPQQFQLQQPFQMSHHNPYNIPQNFNNIIQHQNINQMTFANNSDKEIDMNISVQN
QKIQSTEELLDSKTLRMRSQSTMIPNQFSQNGVYQFQPHNQQLGGFQHCQDGFFTTMNND
ALDKFEVPFVDLSNSNPLNDTGNPSLYSNNLPQMMNNSYLLNQQLHQQQFANHYRPNFNN
NGHPQVSNFDTNYQHHVMRSVSDVGIYHKFQNQAQLQGNNYQEDFFDIDNPIISHRDNIL
LDRCMSPAASLHLNEF