Identifiers and Description

Gene Model Identifier

Contig16439.0.g105

Standard Name

MYB2

Aliases

Contig16439_0_g105

Description

Myb-like DNA-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005718901.999683289470905e-41Myb-like DNA-binding domain co
ntaining protein
SGDYMR213W0.000000007002490258088747CEF1 SGDID:S000004826, Chr XII
I from 693381-695153, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16439.0.g105(coding)
ATGTCAGCTGTGATGCAGAGCGGAGGTGGACCCAATTAAAATAAAAGATAGGCCAAGGCA
GCCTAGAAAGATAAAAAGAGCAATACTAAGAAAAAGGCCAGTGATTTGGAGGAGGTGAAG
GAAAAAGGAGATTCAGATATTGATCTTAATGAGTCAGACTACGACATATTCTCAGATCAT
GATGATAAAAAGAATATTAAAAAGAGGAAAAGTAAAACAACTTCTAGAAAGCTGTGGATA
TAATCAGAAGATGAGGCCATAGAAAAACTTGTATAAAAATATGGAACTAAAAGGTGGACT
TTTATAGCTTAAAAATTAAAGGAAGAGTTTAAGATTAATGGTAGAACTGGAAAATAATGC
AGAGAAAGATGGCACAATCACTTAGATCCAGATATAAAGAAAGATCCTATCAGTATATTT
GAAGAAAAGAGTATATTTGAAACACACAAAAAATTCGGAAATAAGTGGGCTGAAATTGCA
AAAATCCTTCCTGGAAGATCCGATAATTGCATAAAGAACTACTATTATTCAACTTTGAGG
AAGCATCTCCGTAGAATAAATAAAAGTCTGAAACAGTGCTAAGTAGCCAAGAGATTGAAC
ATAAAAGTGAAGGCATTGACTGCAGATTATTTATACAGTCTTGTTAGAGACAAAAAAGTG
ACGTATGAGTAAATTCGTGAAGTAGATGCTAAAAGGTTCCAAGATTTAGAGTATACCATG
AGACTTATTTTTAATCATGACGATGACCAAGTTACCAACTCCTTGACACTAGGATTGCAA
TAGTATAGTTAATCCAAGTTAGAGGAGATAAAACGCAAGCAAGAAGAAGAGTAACAGAGG
CTTTATCACTAATAACTGCTAGAGTACTCAAAGCGTCGATCTCCCAGATTAAGTCAAAAG
CAGAGAAAGCACTACGATGATGGTGAGAATATAAAAATGCTCTTGCAACTTATAAAAAGA
GAAAAAGCACAGCTTCTTATTACTTAGTCGAAAAAACGCAAGAGAACAGATTAACTAGAG
GATGGTAGTAGCGTGGCAAATATTGATGGACCTGGGGATCAAATTTTTAACGAAGAAGAA
GGAACTATTCAAAATAGAAAAGTGTCTGACTTTTAGAATATGGGGTCTCCTATTGCAAGA
AGATCTATAGATGATATTGAGAGAAAGCAAGTAATTGAGCTTAGAGGCGATGGAAAAAGA
CCAATAAAAAGGACACCAAAAATGGAAAGTTACACACAATAAGCTGAAAAGAAGGATCCA
AAAATTTAGAAACGCTTGAAGAAAAAGAGGCTTGTTTATGATAATTAAGAGCATGATTTA
CAGCTTATAGAGAAATAGTTCTCCTCTAATAGTGCTAATAACTAACAACAAAAAACTGAA
TAGGTAGATGACGGACAACAGCTTTTACTTTCGATAATGAAAAAGAGACATCAAGCTATG
AACTAAGAAAGGCTTAAACAATAAAAGCAAGTTTTTATGCACCAATAGTAAATATCTTAA
AGCTCACAAAGCTCTTAAATGATGCAATCTCTTCACATTTAAAAATAAAGCTCAAGCGTT
TCAATAAGTCAGCAACATTAAGATCTTGACATAATTTAAAAGCAGTAAAGCTTGTTTTTC
AAGCAGGATAGCGTAATGAATAACTTTTCTACTCTTAACTAATTGATCTTGAATGAAAAA
CAGAGCTCAAGCAATAATTCAATCAGATAACAAAATCCCATGGCTTTCAGATAGCAACAT
TAAATGAATCAATAAGGAGACCCCATATTTGATAATAGTGGAGCAATTCCTATCCCACAT
AATTTTGGCTTCAGTTAATACTAGGGACTTCATCCAAATATGCCATAGTAATTTGGTTAA
GGTTTCACAATCAATTAACAAACATAGAAGTAGCCATCTGAACTTAATATTGATTTCTAA
AATTCTATAAATTTGCAACATTCTTAGCTACCAATGAATCAAATGAGGCATTAATTCTCT
GTCAACAATAATGACAGACTCATAACTCCATCAAACAATTATAATATTCATATTGAATCA
ACTACTCCACAGTAAATAATTTTCTAATTTCCTGAGCAAAGAACTATTTAGTCGCCTCTC
TACTTGCCCTTCAACCAAAAGAGCTACATATTTAGAGAATCGCCGAAAACTAAGTTGAGA
ATCTCTCTGGCCTCTAGCCATAGTAACAAAGTTCAGTTTAAGGACAACCCAGACAATAGT
AGCAGTAACCTTAACAGTAATAGCATGACAAAGATGAATGACTTAATTTGATCTCTAAAC
AACGAAAACTCCCCAGACAAAAACAAAGTTGATTAGCCACCTCTAGCTCCTGTATTCAGC
GATTTAAAACCAAAACTAATTGAAAGTTCAAGTACCTTCACAAGAAAATCTTTCTAAGAT
GTAATGAAAAAGAAAGCAACGCCCTTGATTAATATTGAAACTTTACAGCCAGAAAAACTT
AATGCTCCAAACCCTAATCTGCTACAGCTTTCTCCTTAAGAATCTTCATCAAATTTAAGT
TTATTTACATCAACTCTAACTCCTTCTCAAATTATGGGCCTAAACTTTTCTCAGGGTATG
GGATAGCAAAAACAGACTCCAATGGGCATGCTTTTCAATGGTACTATAAAGATTAACCCA
AATTTATCAGTCTCAGACTTGAAACTCATTGGTTAAATATCTTAAAGTCCTATGAATAAA
AATCCTTAGCAATAATGGTTATTAAACAACAATCCCAAGCTTGTGAGTCCAAGACCTATG
GTAAAAACTTCAGACTTCGGTGCACCCCATAGTTAATAAGCTAATTTTAACATGCCTTCT
GCTCAAATTAAGCCTAGCCCAAATTCAGGCTTTCACTAATATTAGAAGCAACAAATGCAG
ATGTTTATTTAACAGCAACAGTAATAATAGCTTTAGCAATAGCAAATGCAACAGCAGTAG
TAATAGTTACAAATGTAGTAAAATTATTAAAAGCCAAATAATGAGGCAAACTAATAAATA
TAAAGTTTTTAAGATCCTGGAGATAAAGATCAGTAATACTTACAGTAGGAACCAAAGAGG
AAAAATTTAGGAAATTCAGCTTAAGAATAATGA


>Contig16439.0.g105(protein)
MSAVMQSGGGPNQNKRQAKAAQKDKKSNTKKKASDLEEVKEKGDSDIDLNESDYDIFSDH
DDKKNIKKRKSKTTSRKLWIQSEDEAIEKLVQKYGTKRWTFIAQKLKEEFKINGRTGKQC
RERWHNHLDPDIKKDPISIFEEKSIFETHKKFGNKWAEIAKILPGRSDNCIKNYYYSTLR
KHLRRINKSLKQCQVAKRLNIKVKALTADYLYSLVRDKKVTYEQIREVDAKRFQDLEYTM
RLIFNHDDDQVTNSLTLGLQQYSQSKLEEIKRKQEEEQQRLYHQQLLEYSKRRSPRLSQK
QRKHYDDGENIKMLLQLIKREKAQLLITQSKKRKRTDQLEDGSSVANIDGPGDQIFNEEE
GTIQNRKVSDFQNMGSPIARRSIDDIERKQVIELRGDGKRPIKRTPKMESYTQQAEKKDP
KIQKRLKKKRLVYDNQEHDLQLIEKQFSSNSANNQQQKTEQVDDGQQLLLSIMKKRHQAM
NQERLKQQKQVFMHQQQISQSSQSSQMMQSLHIQKQSSSVSISQQHQDLDIIQKQQSLFF
KQDSVMNNFSTLNQLILNEKQSSSNNSIRQQNPMAFRQQHQMNQQGDPIFDNSGAIPIPH
NFGFSQYQGLHPNMPQQFGQGFTINQQTQKQPSELNIDFQNSINLQHSQLPMNQMRHQFS
VNNNDRLITPSNNYNIHIESTTPQQIIFQFPEQRTIQSPLYLPFNQKSYIFRESPKTKLR
ISLASSHSNKVQFKDNPDNSSSNLNSNSMTKMNDLIXSLNNENSPDKNKVDQPPLAPVFS
DLKPKLIESSSTFTRKSFQDVMKKKATPLINIETLQPEKLNAPNPNLLQLSPQESSSNLS
LFTSTLTPSQIMGLNFSQGMGQQKQTPMGMLFNGTIKINPNLSVSDLKLIGQISQSPMNK
NPQQQWLLNNNPKLVSPRPMVKTSDFGAPHSQQANFNMPSAQIKPSPNSGFHQYQKQQMQ
MFIQQQQQQQLQQQQMQQQQQQLQMQQNYQKPNNEANQQIQSFQDPGDKDQQYLQQEPKR
KNLGNSAQEQ