Identifiers and Description

Gene Model Identifier

Contig19732.0.g27

Standard Name

MYB18

Aliases

Contig19732_0_g27

Description

Myb-like DNA-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002029406.998542127613979e-20myb-like DNA-binding domain, S
HAQKYF class fa...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19732.0.g27(coding)
ATGTAAGCACGTCGTTCAATCACCAAATAAGTCAGAGACTACCAAAATCCAAAGAAAAAC
AATCAGTTTTCTCCATCGCCAATCAAGAGATACGTGAGTTCAAAATCATTCAGCCATCAT
TAATCTCAAAGTAATTAAGCTCATGATAATCTCAATAAAGAGAACCTTAATGGCAATCAG
AGCATAAAAGACGCCAACCTAAGTTCAGCACCGAGTTTTTCYCAGAGCAGAGGCCGCAGA
AAGCCGCTTTAATAACTTTTCAATGAGCTCTCATCCCATAATTCTGCTGATTACGGGAAA
GTGGATATCAATAGAAAAGTATCAGATCTTTTGAAATTAGAGAGCAAGGGCCCTATATCT
AGTATTAAGCAAAATCAAAACACTAAAAGCCATACTGATTAAGCAGCACTTGACATATAG
CCAAAGGATTCATAAAATGAGACTGTACTTAAAGAGCATAATCAAGGTACAAAATAGGAA
GATTTAAAAAAGCGCCCATCAGAGATTCTAAATTCAAAAAAGAAGAGAGTAGAGAAGCAA
GAATCAAAGAATCAATCAGTTGATTAAAGCGTCATCAATCAAGATTTAAATTCAGAAAAT
CTCAAACAAGATTAATTAAATTCAAATTAGGAAGCTACTATGATGGCGTAAGTATAAAAT
CAAAATAAAGATAGAGTAGTAGTGGATCAAGATATGGTATAGCAAACAAACTTGGAATAA
GAGTCCTCTAGCGATGCTAGTTATTAAAATGAGAATTCAAAAGATTTGGCTGAATTTGAA
AATCAAGACTCACAAGATGACTGTGATATGGATATGGGCTCAGTTTCAGATTAGTAGCAC
CCACAGAGAAGCCACATTAACCTCACTTAAAATACTCTAATAGTTCCAAACCCAAACAAC
CCAAATGCTATGCAATACTCAGGCAGATGGACTGATGAGGAACATGAGAAGTTTTTGGTG
GGACTAAAAATTTACGGAAAAGACTGGAGACTTATAGAAGAATATATCGGTTCAAGAACT
TGCGCTCAAATCAGATCTCACGCATAAAAGTATTTCAATAAACTAAACAGAAATAGTTCA
AAGAGAGCTTAAAAGCTTCTTGCTGAAAAGTAAACTTTGGGTAAAAGAGTGCATTAAGAG
CCGAGGTAATCTTAATAGGTTCCTGTTACTCAAAAAGAATAACTCACTACTACTCCGCTC
TCATAGCCAAAGGTCTTGCCTAATTTGGATCAAATAAAAAGTATAACATAAGCACCCTCG
AACTTGTTTATAAATAAACCAGAAAATCTGAATTTAAGTTCGATTAAAGAGTAAACCAGA
GAATAAATGTCTAAGATTCATGAAAACTTCGAAAAGATCACTGAATCTGAACTTCATATC
CAACTTTAAGCTTTAATTCAACAAAGAGAAAAAGTTTCCTTAAACTTTTTACTAAAACAG
ATAAGCTCTGTAGATGCTTGTAGAATTCTAATTCAAATAACTAATCAGTTTCATGAATAA
GCAATGAAAGCTCTCAAAAGCTGCAAATTTGAATTAAGCAATAGGATGGTTGATGAAAGA
AACTTAACTCAATTTATTTGCATCCTACTTTCAAAATAAGTGCAAATCCTGCCTCCAAGT
GCTTAAAACCAAGCAAATCCAGAGGAAGATATTATTCAGCACGTTACAGCAACTCACTCT
CAAGGGTCTTAAATAGACAACGATGTTGAATTGAGATCTTAAGCAAACACCTTACAGAAG
AGACCCAAGATTTAAGAAAAGACTCCAGACTAATTTTAAACTAGATTCATGCAGCCAAAC
TTCAATTTAGGGAGAGATTCCATCACTCCGTTTAGATCCTTAGTGAAAACCCCAAATCCC
ATTCACAGACTTTTACCTGACGATAACAAGCTCTCTGAAATTAAGAGTGACTTACTCATA
AAGAATATCCTTGGAGGTGGTAACAATTTTGACATGAATTTACTAAGCGGAATAATTCCA
GCTTCAGTCTCTGCATCTGCTTAGAAGCAAATTGGAGGCATAATAAGCTCTGATAAGAAA
AACAAACAATGA


>Contig19732.0.g27(protein)
MQARRSITKQVRDYQNPKKNNQFSPSPIKRYVSSKSFSHHQSQSNQAHDNLNKENLNGNQ
SIKDANLSSAPSFXQSRGRRKPLQQLFNELSSHNSADYGKVDINRKVSDLLKLESKGPIS
SIKQNQNTKSHTDQAALDIQPKDSQNETVLKEHNQGTKQEDLKKRPSEILNSKKKRVEKQ
ESKNQSVDQSVINQDLNSENLKQDQLNSNQEATMMAQVQNQNKDRVVVDQDMVQQTNLEQ
ESSSDASYQNENSKDLAEFENQDSQDDCDMDMGSVSDQQHPQRSHINLTQNTLIVPNPNN
PNAMQYSGRWTDEEHEKFLVGLKIYGKDWRLIEEYIGSRTCAQIRSHAQKYFNKLNRNSS
KRAQKLLAEKQTLGKRVHQEPRQSQQVPVTQKEQLTTTPLSQPKVLPNLDQIKSITQAPS
NLFINKPENLNLSSIKEQTREQMSKIHENFEKITESELHIQLQALIQQREKVSLNFLLKQ
ISSVDACRILIQITNQFHEQAMKALKSCKFELSNRMVDERNLTQFICILLSKQVQILPPS
AQNQANPEEDIIQHVTATHSQGSQIDNDVELRSQANTLQKRPKIQEKTPDQFQTRFMQPN
FNLGRDSITPFRSLVKTPNPIHRLLPDDNKLSEIKSDLLIKNILGGGNNFDMNLLSGIIP
ASVSASAQKQIGGIISSDKKNKQ