Identifiers and Description

Gene Model Identifier

Contig1271.1.g45

Standard Name

MYB11

Aliases

Contig1271_1_g45

Description

Myb-like DNA-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008423803.999925618735366e-62Myb-like DNA-binding domain co
ntaining protein
SGDYKR099W9.997764199084386e-16BAS1 SGDID:S000001807, Chr XI
from 635851-638286, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1271.1.g45(coding)
ATGAATAGAGATTCACTTAGTAAGAGAGGAATTAACGATATTTCTAATCAGGCATCAAAT
ATTTAAAAACCTGGTAAAGACATAATAAATAAGTAAGAAGAAAACAATGAGAAATTTAAA
CATCACTCCTTAAGAAGTGGCAAAATAATTTAAAAGCCTGTGTTCATACCACCCAAGGAA
AAGATTCAAATTAAAGTCGAGGAAGTTCATTAGCCAAGCTCCCCTTAAGCTAACAAGAAC
TTAGAATCAGGCATTAGCCCAACTTTTTCGGAAGTGGTATAAAAAAGCTAGCTTCAAGAG
ACCACTTGCGCAACTATGTCATTACTTCAAATGAAAGGTCAGGGCGTGACTCCTAGTGAA
GGAGCCCCCACACCCTTCTTTATGGTTTCTAATGATTCAAATCACTCCAGCGACAAGCTT
GAAGAGCCAGTAAAGAGTGAGGAGACTAAATAATCGGGAACCGAGCAAGGACCAGCACTT
CAAGCCTCTACCAGTAATTACTCGAAGAGGGCTAACAGAGGCTACAATCCTAAATATGAA
TAAGGCAGCTTCGTTTCATTCACATCCCTCTGTGGTACTAAACGTAGATAAGCTGAAGGC
CACGCTGTTTAAAAAGCTAGCAACAAGGAAAATTTCAAAAATCAAATATAATCATCACTA
AAGACACAGAAGGAGGAGAAAAGTAACACTTCCCCTCTTAGCTCTAAAAATAGCAATATC
TTAATAAAATTGCCAAGTCCCACTTAAGAAGTGAAACCTTAACAAACAGTTGCACTTTTT
ACTCCAAAGTACGAGCTCACTGAGTCTTCCAGTGCTTTTATGAAGATTGATAATTAAATT
CAAATTAAGCAGGAGTATAAAAATGACACGCTAAAAGGAGAGAAGAATGACTATGATTCA
GACAATGATGACTGCGACTCAGAAAATGACTCTTACGGAGATGAGGATGACGAAAGTGAT
GGAGTCAAGAGATCTTCAGGCTTGATATATCACGAGATGCCTCTTGGCTCAAGAACCAAC
TATAAAGGGCACTGGACTAAAGAAGAGGACTTACATCTTTCAGAAGCCGTCAAGAGACAC
GGAGGTAAAAATTGGAAAAAGATCGCTGAGGAGCTTCCAGGAAGAACAGACGTCTAGTGT
CTGCACAGATGGTAAAAAGTCCTCAATCCCTCACTTATTAAGGGTCCCTGGACTGAGGAG
GAAGATAGAATGGTCCTTCATTTGGTTGAGAAAAACGGTCCCTAAAAATGGACTTTAATT
GCGGAAAACCTCCCAGGCCGTATTGGAAAATAATGCAGGGAGAGATGGCACAATCATCTT
AACCCAAAGATCAAGAAGATCGGCTGGAGCAAAGAGGAAGAGTGGATTTTATACTTAATG
CATAGAGGCAACGGCAACAAGTGGGCTGAGATCGCTAAGGTCTTGGAGGGCAGAACTGAC
AACACTATTAAAAATCACTGGAACAGCTCAATGAAAAAGAAACTTATTGAGATGAGCAGA
AGCTTAGACACCTACCTAAGAGATTAGATATCCAAGAAGCTAAATATCTCTGATCCAGCT
TCCATAAGGTACGATAACGGTGATGAAAAAGTACTTTCAACAAAGCACGAGCTTGAGACT
TAACTCTTGAAGAAAAATGTAGATGAAGTCGAAAAGTAAAACAAAGAATACTTTGAATCC
AAGGCAAGAGACCTCCTTGAGATGAGAAAGCATGATGCTGTTAGTCTTGCTACAGCTAAC
CTACTCTTTAAAAGTCTTAATATTAATATGGAACAGTATATTTTGAAGCTCTAAAAACTT
AACGCCTAAGCCAAAATTGAGAAGGAAGAACCTTCACCATAAGTTGTTTCTTAAAATTAA
CCAGCTCGATAATAGCAAATATAACATCACTAAGCTTAATAACCCTCAGTTATTAAACAA
GAAAAGCAAGAAGCCGCTCAGCCAGCTCAATCTCCTTAACACTTCAGCGCACTTTAAAAC
AACGTTTAATTGAAAACAAAAGTCAAATAGAGCACTTCTACTCCAAACAACAAGCTTGTG
AATCAGTTGCCTAAGAAATCCTGTGGGCAAGTTGGAAGAAAAAGAAAGTACCTGTACAAG
TAGCAAATCACACAATCTCAGTCTATGCAGTACTCTTCGATTAGCCAAGCCTACAGTCAA
GCTTGCTATTATAATTAAGCTACCAGCAGCACTGGAGTCACTATAGATGCAAATCAAATC
TTCCCAATCTTCTAAACCCCAGACAAGAAGAGATAGAAACTTGCTCACCACGGTTACGAT
TTACATCATCCTCACATTAATAACAACTAAGAGAACATCAACCACTTGAATTTACCTCAA
GTCAATCCATACTCATAGCAACATGGATCCCATGGTCACTCTTAATATCCTGCAGGTCAA
GCCTACTCACATAGACAAAATTTGATAAAGTAGCAGAACTCTTACCTTGGTCCTTCATAG
TAAAATTTGATAAATGGAGAGAAATTTGTGTTCAATAACATTACAAATAATTACTATCAG
ATATCTAACCCAGACTTACTTGGTTAACACGCCTCACCCCTTATAAAATAAGGCTGTGGG
GAGCATACTTTCGCTTAAAACAATAACAACAGTAAGTCCAAGAATAACTACGACTGGTTC
TAGGGATCTTAAAACAAGTCAAGCAATAAATACGGTTAGCATCACTCCCCTGATTTCCAC
AGCGGCTTTAAGATGTAAAGTCATTAAAAGATTTTCAATTCATCCCTCTCAAATTCAAAG
TTCCAAACCACCAACTTTGAAGCCAAGGCCTACAGGACTCTCATGAACATGAGTGAGAGT
GCCTAGAAATCTAAGAATTAATATAGTATCAATCATCCTCATCATCACTTGTTAAGTGGA
AGTGGAGGGTTCACTAGTATTATCTAGAATCATAACAACCCACTTAGCATTAGCCCCATG
TTAACTAAGTCAGTTTCATGCTTTGATCCAGTACTTAACCAAGATTTAGTATTTAACGGC
ACTAATATGTCAGGTGCATTTAGACAATTACAAAGACCAGACCATAGTAAGATTAGAAAG
TCAAGCGACGGTGCTCATGGTTAAACCTTATAGCAAAACTAATAGCCAACAAGTCTTCTA
AACTTCAATATTGGTACAATCTTTAATAACGATGAGTCTCCATACAAGGGATTAGAATCA
CTATTCAAGGCAGCAAAGTGA


>Contig1271.1.g45(protein)
MNRDSLSKRGINDISNQASNIQKPGKDIINKQEENNEKFKHHSLRSGKIIQKPVFIPPKE
KIQIKVEEVHQPSSPQANKNLESGISPTFSEVVQKSQLQETTCATMSLLQMKGQGVTPSE
GAPTPFFMVSNDSNHSSDKLEEPVKSEETKQSGTEQGPALQASTSNYSKRANRGYNPKYE
QGSFVSFTSLCGTKRRQAEGHAVQKASNKENFKNQIQSSLKTQKEEKSNTSPLSSKNSNI
LIKLPSPTQEVKPQQTVALFTPKYELTESSSAFMKIDNQIQIKQEYKNDTLKGEKNDYDS
DNDDCDSENDSYGDEDDESDGVKRSSGLIYHEMPLGSRTNYKGHWTKEEDLHLSEAVKRH
GGKNWKKIAEELPGRTDVQCLHRWQKVLNPSLIKGPWTEEEDRMVLHLVEKNGPQKWTLI
AENLPGRIGKQCRERWHNHLNPKIKKIGWSKEEEWILYLMHRGNGNKWAEIAKVLEGRTD
NTIKNHWNSSMKKKLIEMSRSLDTYLRDQISKKLNISDPASIRYDNGDEKVLSTKHELET
QLLKKNVDEVEKQNKEYFESKARDLLEMRKHDAVSLATANLLFKSLNINMEQYILKLQKL
NAQAKIEKEEPSPQVVSQNQPARQQQIQHHQAQQPSVIKQEKQEAAQPAQSPQHFSALQN
NVQLKTKVKQSTSTPNNKLVNQLPKKSCGQVGRKRKYLYKQQITQSQSMQYSSISQAYSQ
ACYYNQATSSTGVTIDANQIFPIFQTPDKKRQKLAHHGYDLHHPHINNNQENINHLNLPQ
VNPYSQQHGSHGHSQYPAGQAYSHRQNLIKQQNSYLGPSQQNLINGEKFVFNNITNNYYQ
ISNPDLLGQHASPLIKQGCGEHTFAQNNNNSKSKNNYDWFQGSQNKSSNKYGQHHSPDFH
SGFKMQSHQKIFNSSLSNSKFQTTNFEAKAYRTLMNMSESAQKSKNQYSINHPHHHLLSG
SGGFTSIIQNHNNPLSISPMLTKSVSCFDPVLNQDLVFNGTNMSGAFRQLQRPDHSKIRK
SSDGAHGQTLQQNQQPTSLLNFNIGTIFNNDESPYKGLESLFKAAK