Identifiers and Description

Gene Model Identifier

Contig22098.0.g36

Standard Name

MYB1

Aliases

Contig22098_0_g36

Description

Myb-like DNA-binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001944703.9997566980151843e-38Myb-like DNA-binding domain co
ntaining protein
SGDYMR213W0.0000000039998859049333245CEF1 SGDID:S000004826, Chr XII
I from 693381-695153, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22098.0.g36(coding)
ATGCTAAACCGCCGCTACTCGAGAGATGATGATTCTATGGAAAATATAGGATAAGCCAGA
AAAGAATCAAGAAGCAGAGATAGAAGTGTTCAATCGTCTTCTTAACGCATTAAACAGGAA
ATTGATATGGTAGAGGATGATAATAATGCAGGAGATAATTTTCAGATTTCACAATCTTAA
TCGATGTTCAGCCAAGTTGAAAGTCTGAAGAAGACCATTCAAAAAGAAAAGATGAAAAGA
GATCATAGTATGTTTCCAAACTTAATTTCAAATATTCTTATAGAGTATAACAGATCAATG
TCTGAGTACAGCGACAAATCTTATGATTCATCAGAAGAGATCAAACTTCAATCTCATAAT
AAATTAGTAGCACAGCATTAGAGAATGAAAACATCAGTGGGAACTGGATAAAACTAAACC
CACAAAACAAATGAGAGCAAAGTCATATCCAATGAAGAAGCAAATGACATATTTTAAAGG
CTTCTGGCTTAAAACAGTAAAAGAAAATATACAACTAAGAGAAATTGGAACGATGATGAA
ACTAAGTTACTTAACTGGGCTATCTCAACCTACTCAGAAAAACGTGGTATCAATGGTGAG
GGCTTTACAGCAGCTGATTGGTAAAACGTGGCCAAGCTGGTGCCTGGAAGAAACGATGCT
TAGTGCTAGTATAAGTGGAACTAAGGACATAAGTCTAGCATCACTAAAACTCAATGGCAA
AAGAAAGAAGATGATGAACTGTTTTCAATAATAAGTGAGAAGGGTACTAAATAATGGTAA
GAAATTGCAGAAGTTCTCAATGCAAAATTGGGGGTGACTCGTAATGGAAAGTAATGCAGA
GAACGTTGGTATAATTTCTTGAACCCAGAAATCAACAGAGATCCATTTAGCAACGACGAG
GATCTGAAAATCTTAAAATTAAGAAAGCAAATCGGTAATAGATGGTCAGAAATCGTTAAA
CAATTACCGGGTAGAACTGAAAATAGCGTTAAGAATCGTTTCAACTGCATGTTCAAGAAA
ATTAAGGATGAAAAGTTACAGAACATCCAAGAGAATGATATGGGGGATGTACTTGAGAAG
ATTGAGAATCAGAACAACGAGAGCACTTTAGACGAGGATGAAATACTTGAGACTCTTATA
ATTAAAAAGACTTAACAAATTCAGCAAGAAAAGCTCAGTTAAGCCATGAATGATCAACAA
AACATAGTTGTGCAGAACAATAATGTTCAATCTAATGAGGGTAGTGATGCGATGATGCAG
AGCGTCAACCTATAAAACTATAACAATGCTTCTTCATAGCTGTAGAGCTCTATTTAATCA
AGCCCATCAATGAATATAAACTGCATGAGATAGGTTCTTAGTCCAGCCTTCGTTGATAAT
CTAGGGACAGAATTATTTATTGGAAACGATGGAAGTTCTAATAGAACAAAGATTAATTAT
GTACTTAAACAAATTATCGAATAGACACCCCAAAACACCAACAAAGTTAAGTACTTAGCT
TAACTTATAGAGTAGGAAGTCAAAGAATCAGTTAAGTTAGCTTTGTAGAAAAACATCGAA
GAAACAATTGAGACAAATAAGTTGCCAAGCACTCTTCAGCAATATAGATTAAGCCGTTAA
GGAAATGATGGCACAAACATAGTCACTTCGGGTAAAATGAGCTTAGATTAAGTTAGTCCA
AATCTTGACTCAGGTGCAAACTAGGGATCTGACCCTAGAACCTCTGGTTAAATGTAAAAA
AGGCCAAGCAGAAGTAATTCAATGGTAGCAAGTCTTGAAAAGTTGACATCTAAACTAATG
AATAGAAATCAAAATTCTACTGAGGGATCTGATATGAAAATAGATTCTAGAATAAATCAG
AAGAAATTTGTAGAAGAAAGTACCAGAGAGATTCTTATAGTGACAAGAGATGGTTGTTAT
ACATACTAAACTCACAACGAGAATCAACTTATAGTTTCAAAACTTAAGGATGTGAGAGAA
ATTTTAGATTCAGGACTTCAGTCGCTGTAACCAGGAATTATATAACCAGGGCAATCTGCT
ACTGGTACACCAAATTAAAATTAGGGTGGTATGCCACAAATGAATCCTAATGACTAGAAA
GCACTTGAAATGTTTTAAATATCTAATGTGTCTGAGATGTTTAGACCAATTCAGCTTAAG
TACACTTAGACCAACTAGCAGCAAATGAATCAGTAGAGATAAGGCTTTACAAAGTTTACT
CCTCCCTTCTCTACTGATAGATAAAAAGTATCGCCTTAAGCTTTCTTGGTCAATGGTCAA
AATGCCTTTTCAAACTAGCAAGCCACCCCAATGTCAAACCTTTCGAATAACACTCCTCCT
TGGAACGTTTACCCTTAATTCCAGCAAATGTAAATGCAAGGAACTTCCCCTCAACAGCAG
CTTGACACCAGATATCTCTTAATGCAGCCCATGTAAAATATGGTATCTCCAGGCCAGTAA
AACCAGCTAAGAAGTAATTAGCTAATTATGGGCCAGACATAGCCCTAGACTGGCTATATC
TCGAACCTCTTAAATAGAAGTGCAAGTTCTGACGTTGTTCTTAACAAGAATTAAAATTAG
ACACCCCCACAGCAGCAGATGTACATGGTTTAAGGGAACCAAGGAATAGGCTAACTTATG
ACTATCAGTCCAAATGACTTGCTTAACAATCAAAGTCACATGCAGTAATAAGCTAGATAT
AGATAAGAATAAAACTAAAATTGA


>Contig22098.0.g36(protein)
MLNRRYSRDDDSMENIGQARKESRSRDRSVQSSSQRIKQEIDMVEDDNNAGDNFQISQSQ
SMFSQVESLKKTIQKEKMKRDHSMFPNLISNILIEYNRSMSEYSDKSYDSSEEIKLQSHN
KLVAQHQRMKTSVGTGQNQTHKTNESKVISNEEANDIFQRLLAQNSKRKYTTKRNWNDDE
TKLLNWAISTYSEKRGINGEGFTAADWQNVAKLVPGRNDAQCQYKWNQGHKSSITKTQWQ
KKEDDELFSIISEKGTKQWQEIAEVLNAKLGVTRNGKQCRERWYNFLNPEINRDPFSNDE
DLKILKLRKQIGNRWSEIVKQLPGRTENSVKNRFNCMFKKIKDEKLQNIQENDMGDVLEK
IENQNNESTLDEDEILETLIIKKTQQIQQEKLSQAMNDQQNIVVQNNNVQSNEGSDAMMQ
SVNLQNYNNASSQLQSSIQSSPSMNINCMRQVLSPAFVDNLGTELFIGNDGSSNRTKINY
VLKQIIEQTPQNTNKVKYLAQLIEQEVKESVKLALQKNIEETIETNKLPSTLQQYRLSRQ
GNDGTNIVTSGKMSLDQVSPNLDSGANQGSDPRTSGQMQKRPSRSNSMVASLEKLTSKLM
NRNQNSTEGSDMKIDSRINQKKFVEESTREILIVTRDGCYTYQTHNENQLIVSKLKDVRE
ILDSGLQSLQPGIIQPGQSATGTPNQNQGGMPQMNPNDQKALEMFQISNVSEMFRPIQLK
YTQTNQQQMNQQRQGFTKFTPPFSTDRQKVSPQAFLVNGQNAFSNQQATPMSNLSNNTPP
WNVYPQFQQMQMQGTSPQQQLDTRYLLMQPMQNMVSPGQQNQLRSNQLIMGQTQPQTGYI
SNLLNRSASSDVVLNKNQNQTPPQQQMYMVQGNQGIGQLMTISPNDLLNNQSHMQQQARY
RQEQNQN