Identifiers and Description

Gene Model Identifier

Contig6347.0.g28

Standard Name

MUTS4

Aliases

Contig6347_0_g28

Description

MutS domain III

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6347.0.g28(coding)
ATGTAGGTTGCTCAAAATTATAAGGAGTTTCTAAAATAAGCTGATTAGACTCCATCTGGA
GCTCTAAAAGATCAAGAAACCTTGGAATATTTCTTAAAAACTGCTGCACAATTGAATATT
TTAAACGAAAGTTTTTGGTAAAAGATTATAGAATCTATACTTGACTAGAGAATTTTCTTA
CACAAAAAGAATTTGCTAAAGGGACTTCACGGATTGAATAAATATGAAAACTCTATTAAG
AAGAGAACTAATTATCAAGAATTAAAAAAAGATATTGACAAAGCAACCAGATCAATTAAG
AAGATTTAGAAAAAAATTGAGTAATTTATTATTCTGTAGGCATAAAATTTGGTTGATAAT
TAAATAGAAACAATAACTCACGAGGAATATTCTCACATTGTGAAGTGGTTGGCTGATCAC
AAGCAAGACATTATTGTTGAAAAATATTTGGAAAAAATTTCAAAGTTTAAGCCAGAGCAA
TTTTCTGTTGCAAATTTCAACTTTATACTTCATGCCGTTAGAGTGAGTGCCAATGTTAAA
CCAGTGTTCAAGCATTAAAGTTTGCAATATGTGTTTAAATCATTAAAAACTTAACAATTT
GATATAAGTCAAGGCTTCAAAGTTTATGTAAAATCAGTAGATTTTAAAGATAATGATAAA
TAAAACAGAAATTCCAGTGAAGTGACTAGTTTGTAAATTACAACTATGCTTAAGATATTA
GAATAGATTTAAGAACAGCTTAAAAAGGACTCTAGAAATAATGACTTGATCTTTTAATTG
GCAAATGTCGCAGAGTTAGCTTCTCTGAGAGGAATTTAAAGAATTGATGACCCAGATTTC
CTGTACATGATACTCAATAATTTGGCAAATATTAGTAGCAATCATTAATTAATTTACCAG
TAACACTTCATTTCCCTTGTCATGATAAATGTTGGACAGGATATTAATTGCTTGAACGGG
AGAGTCATAAAATCTCTAAGCAAGCTTGGGATTAGTGATATCGATTTTTGGTTATATATT
GAAGAGTAGTATCTAAAAATCATAGAAAAAGAACAGTAATCTGATCTTGTAGAAGCATTG
GTTGGTCTAGCTATTATTAAAAGAGGGACAACAGTACTTTACCAGTAAATTTAGTAGAAA
TTACTTTAATTAATTGATGAGTTAAAAGGAATGGATATTTGTAGAACTTATTTTGCCATT
AGTTAAATCCCAATTGGAAAATAAAACCAAGATCTTATTTCAAATCTAATTGAAAAAATA
AATGAAAAATACAATTAAACTCAATCTGAAGGTAAATTGGAGAAGAAACTTCATTACATT
GATTTGCTTAATATACTTCAAGGTGAATGTAATTTTGGGTTTTAAAATGAGTTTATTATT
GAAGAATGTCAAAGATTGCTCTTATTAATGATCAAAAGCAAGAAGGAAAGTAAGCTTGAC
CCAAAGATCTCAGTTAACATATTTACAATTTTTCAAAAACTCTACTTAAATTACTATAAA
GTAAAGTAAACTGATGGAGATAGTACTTCTATTTCAGCAAATATCCAAATCCCTAAACCT
CTGATCAATGAAGATCTCGAGCTGATGTTATTAGACCATTTATTAAATGAGTTCAGTAGT
TACTAATTGGATTAATTTCAATAATGCATCGCTGTTCTAAAAAGAATCGACGAACAATAG
TTCTTAGAGTAACTAAGAGAACATATTTTTACATAGTCTCAGCAAGGTACAATTGATAGT
TTCTAACTCAAGTCGTTTTTAGAGTGTTTTTGA


>Contig6347.0.g28(protein)
MQVAQNYKEFLKQADQTPSGALKDQETLEYFLKTAAQLNILNESFWQKIIESILDQRIFL
HKKNLLKGLHGLNKYENSIKKRTNYQELKKDIDKATRSIKKIQKKIEQFIILQAQNLVDN
QIETITHEEYSHIVKWLADHKQDIIVEKYLEKISKFKPEQFSVANFNFILHAVRVSANVK
PVFKHQSLQYVFKSLKTQQFDISQGFKVYVKSVDFKDNDKQNRNSSEVTSLQITTMLKIL
EQIQEQLKKDSRNNDLIFQLANVAELASLRGIQRIDDPDFLYMILNNLANISSNHQLIYQ
QHFISLVMINVGQDINCLNGRVIKSLSKLGISDIDFWLYIEEQYLKIIEKEQQSDLVEAL
VGLAIIKRGTTVLYQQIQQKLLQLIDELKGMDICRTYFAISQIPIGKQNQDLISNLIEKI
NEKYNQTQSEGKLEKKLHYIDLLNILQGECNFGFQNEFIIEECQRLLLLMIKSKKESKLD
PKISVNIFTIFQKLYLNYYKVKQTDGDSTSISANIQIPKPLINEDLELMLLDHLLNEFSS
YQLDQFQQCIAVLKRIDEQQFLEQLREHIFTQSQQGTIDSFQLKSFLECF