Identifiers and Description

Gene Model Identifier

Contig21026.0.g70

Standard Name

MUTS3

Aliases

Contig21026_0_g70

Description

MutS domain II

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21026.0.g70(coding)
ATGAACAACTCACAACTGACCAATACAACATCGGCTACAACCAACACCAGTGCTACAGCC
TATACAGAACCCACAGAATCCAGACTTTAATTCCTCTCAGAGGCTGAAATAGATGCAGAA
ATTTAACGTTTACAAGAGAAGGAACTCACTTTACAGAATAACAATTAGCGTCTCTCTAAT
TAAATGAATGATTTGCGTGAACTCATGCGCATGGTGGACAACAGACATGACTAAGATGCT
AAACAGCTTTTGAATAGGAATAAAGATCTGGAGAAAGAGATTAAGAGCTTGAAGTAGGCA
TTGGAAGTGCAGGAGAATCACGGGCATCACCTCTCTGATATGGCAGAGTTCTGGCATCAA
GATAAGAGAAAGGAATGA


>Contig21026.0.g70(protein)
MNNSQLTNTTSATTNTSATAYTEPTESRLQFLSEAEIDAEIQRLQEKELTLQNNNQRLSN
QMNDLRELMRMVDNRHDQDAKQLLNRNKDLEKEIKSLKQALEVQENHGHHLSDMAEFWHQ
DKRKE