Identifiers and Description

Gene Model Identifier

Contig13029.0.g41

Standard Name

MUTL1

Aliases

Contig13029_0_g41

Description

MutL C terminal dimerisation domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam08676 ) MutL C terminal dimerisation domain
  • ( pfam01119 ) DNA mismatch repair protein, C-terminal domain
  • ( pfam02518 ) Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
  • ( pfam13589 ) Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011099401.000137892321693e-31DNA mismatch repair protein, C
-terminal domai...
SGDYNL082W3.998693556225637e-29PMS1 SGDID:S000005026, Chr XIV
from 473391-476012, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13029.0.g41(coding)
ATGCCTTTAAGAGATGGACAGCAAAAAACTACTAAAAATAAAAATTGTGAAAATAGCCAA
GGCAATTCTCAGAAAAGTTAACTTGTTCAAGTTTCTGATATTAAAGTTAGAGATTTGGAC
ACTCTTTTACGAATATGGGTGATATAGCTTGTTGAAAACGCATTAGAAAGGGGTGCTAAA
TATATTGAGGTTTGCTTATATCAACTAGGAAAAGAAGGTTTTGATGTAATAGATAACGGG
AGAGGAATTGATGAAAATGAGTTTACAGATGACTATGTAGCAGCAGAGCTAACAATTCTA
ACCAAAAGTGTTCATTATCCAGATGCATGTGTTGTCAAATATAATCATAAAATGCAGAGA
TCAGAGAAATTCTATGTTGATTCTCGAAAACTTTTAGATGAAGAGCTAAGATTTACAAAT
AGTCAAACCGTCATCGATAATTTGAATGACAAGAATTTTGAACCATAGTAATGTATCCAC
ATGTATGTAAATGGGAGACCAGTTGAATCAACAAAAAGAATGAAAGCGATCTTCTAATAA
CTTTACAGAGATTTCATGATTGCAGAAAAGACTATCCCTTTCGTTTTTATGAGTATAGAA
ACTACGCATTAAAATTATGATTTAAAACTTTAAGCTGATATCAGGAAGTTCTTCTTTAAG
CCAGAAATAGAGAAAAACGTTTATGAAAAAATAAGATCGCTTTTCTTACAAAGATTTAAT
TAGATGTGTCCACTTTATACTGATGAGTAGATCTTTAAAAGGCAATAGGCTGATCTAGAA
ATATAAGGTGACTCCTAAGAAATCTTTGACTATAACTCTTAAGGTTATAAACAGCAAAGC
TAAGAAATATAAGAAATAAAGAGTTTCTAGGAGATCTAGGAAATTAGGAATAATCCACTA
AGATAAGTTCAAATGTACACAGCACCAGGGGGAGAGGACCCCACGAAATTCTTTCCAGAA
TAAAATATAATTAAGGTTAGCCCTTCAGTAATGAAAAAGAAGCTTAAAAAGCTCAAGTAC
AGAAAGTATCCTTTAAAGAAACTTGTGAATGTTTATGTAATCTCAAATTCCCCTGCTATG
TCAGATGAGGAGGATCAAAGAAAACTATCTTATCTCTATGAAGACGATGAGGAATTTTTA
AAAGATGAGGATATCATGATGGAACCTGAAAGCAAAAGAATGAAAATTTAAGATCTTGCT
TAATTTGAAACTGGCTTTGTAAAGACTCTTGAAGAACAAGATACAAATGATGATGATGGA
GATGACGATTTAGAATCTATAGACTAGAAAACATGCTTCTCGGAGGATTCAACTACAGCA
ACATACTTTCCTGAATATACTTAATCAATATCTAGAATGTCCACTATAAATTTCTATGAC
TAAGAACAGTTCTTTAGTGAATAATTTGAGAATTTTAAAAATGACAAGTCTTTGTACTTT
TCCCTAGAATAAATGATCTTTAATGAATAACCTTTCGAGCTTGAAGACTTAGATACCTAA
ACTGTTTCTAAATTCAGTTTTAAGTAAAGATTGAGACCTAAGTTTCAAAGATCAACTTAT
GAAAATCATTAATATTATCATGACAGACTTATGTTTGATCTTAACAACGATATGATGAGA
AAGAAATTTTGGAAGAAAGAGTTCATGAGGCTACGAATCCTAGGCCAATTTAACAATGGA
TTCATAATAGGCAACTTAAATCAAAACGACATCTTCATTTTAGATTAGCATGCTTGTGAT
GAAAGATTGCATCTTGAAAAGTACACTGGTTCTTTGAAGATTGATTCATAGCCATTAATC
CAACCAATTATAATTTAGTATGATACTGAGCTCTATGAAATACTAGAAACTTACTAAAGA
ATCTTTAATGCTTTTGGCTTTTAATTTGAGAAAATGTTCTGGAACAAATATTAAGTCCAA
ATTAAGGTTCATTCTTTACCCTAAAGCAACGACACCTAATTCGAAGAAAGTGATTTTCAT
AATCTGGTAACAGCTATCAGAAACTTTGATACAGATGATAGAACGAAAAATAAGTATATA
ACTGATTAGTAAATATTTGACTATCTGATGCCAAAGAAAATTATGCAAGTCCTAGCTCTA
AAAGCTTGCCGAAAATCAGTAATGGTTGGCAAGAAATTAGAGAGACGATAGCAGTATGAA
ATTGTGAGTGGGCTGAGCAACCTCAAGGATCCTTGGATTTGTGCTCATGGTCGTCCAACA
ATGAGATACATCATGGACATATAAGATTTTTAAGATAAGTTACTACTCAGATCAACTGGG
GATGATAGGCTTCCTCCAAAATTAGAACTAAAACTAAATAGGCTTTAATTAAAGAAAGAT
TAATTAATTTGA


>Contig13029.0.g41(protein)
MPLRDGQQKTTKNKNCENSQGNSQKSQLVQVSDIKVRDLDTLLRIWVIQLVENALERGAK
YIEVCLYQLGKEGFDVIDNGRGIDENEFTDDYVAAELTILTKSVHYPDACVVKYNHKMQR
SEKFYVDSRKLLDEELRFTNSQTVIDNLNDKNFEPQQCIHMYVNGRPVESTKRMKAIFQQ
LYRDFMIAEKTIPFVFMSIETTHQNYDLKLQADIRKFFFKPEIEKNVYEKIRSLFLQRFN
QMCPLYTDEQIFKRQQADLEIQGDSQEIFDYNSQGYKQQSQEIQEIKSFQEIQEIRNNPL
RQVQMYTAPGGEDPTKFFPEQNIIKVSPSVMKKKLKKLKYRKYPLKKLVNVYVISNSPAM
SDEEDQRKLSYLYEDDEEFLKDEDIMMEPESKRMKIQDLAQFETGFVKTLEEQDTNDDDG
DDDLESIDQKTCFSEDSTTATYFPEYTQSISRMSTINFYDQEQFFSEQFENFKNDKSLYF
SLEQMIFNEQPFELEDLDTQTVSKFSFKQRLRPKFQRSTYENHQYYHDRLMFDLNNDMMR
KKFWKKEFMRLRILGQFNNGFIIGNLNQNDIFILDQHACDERLHLEKYTGSLKIDSQPLI
QPIIIQYDTELYEILETYQRIFNAFGFQFEKMFWNKYQVQIKVHSLPQSNDTQFEESDFH
NLVTAIRNFDTDDRTKNKYITDQQIFDYLMPKKIMQVLALKACRKSVMVGKKLERRQQYE
IVSGLSNLKDPWICAHGRPTMRYIMDIQDFQDKLLLRSTGDDRLPPKLELKLNRLQLKKD
QLI