Identifiers and Description

Gene Model Identifier

Contig261.0.g68

Standard Name

MULE7

Aliases

Contig261_0_g68

Description

MULE transposase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig261.0.g68(coding)
ATGCTATAACAAATGCTACAAAATTATCGAGGCATGATATAGGAGCTTACTAAGATTGAA
AAGAAAATTAACAATATTCCCAGGCTTTTCAAGGGAAAAACTATAAATCTCTCAAATCGA
TAAGTAAAATAGCCAAGAGCAATAGGCGAGAATAAGAGAAGCCGAACTCGTGATCCTTTA
GATGCAAGCAGAACGAGGTCATCTTATCCAAAACATATAAATGAATACGCTAGATTGATA
GCCGAATTTTAAAGAATTAAAATGGATGAAGAACATAAAGAGTAACAAGTTTACTTTGCA
ATTGAAGAATAATTAGACAAAGCTGGTTGGTACAATAACATATTTTTCAAGTCAAATTCT
ATGCATGAAAATTTTATGACTTATCGAGATGTGGTTTTTATCAATAAAAGGCTCGCTAAA
ACTCGATATAATAGAATCTTGCTTGTGTTCTATGGGATAAATTCAAATGGGAAGTCAGTT
ATATTTTCTATTTGCTTCATTCATAAGGAAGATGAAGAGAATTATGAATTTGCAATAAGC
AATTTTAAGAAAGCTTTGTGCGATGATGTTAATCCTAAAATCTTTATTATTGAAAGAAAC
AGCAGTTTAAAAACAACTATTTAAAAGCAATTTTCTAACTAGATGAGGGTTTTGTTTTGC
TTTGATCATTATTAGAAATCAATTAGGCATTATTTTGATAATGCAAAAGGTTCTCAACAA
AAATACTTAAGCAAAGCCTTATAATTATTGGAGCCTTTACCTTAGATTGAGGATTAGAGA
TATTTCGAAAGTTAAATGGATGAGCTAAAGAAAGAGTAGCAAGAATATGCAAATAATAAT
GATAAACTTTTCTAGCTCTTGGATAAGATACATAATGAAAGGAATTCTTGGGCTAGAGTA
TAACATTTGTAAAACTTTACGGGAGCATTCAAAGTGTGCGAGAGAAATGAAGTTATTAAG
AATTTCATGTATCATTTGATTAATCGCAAAGATACTCCTATAGAAGAAACAGCGAGAATT
TTATCGAAATCTGACTGTATTAAACATCCAACTCACTGCTTTGAAGAATTTAAATTAGTT
AAACTCAATTAATTAGAAGAGATACCATTTGTGGCAGATTACATAAGAGAAAACTTAACA
AACTATGCCAATAATCGAATAAGAAACAGTATAGCTATTGGCTTTAAGGACTATAGAATA
ACTAGGCACGATAAAATGACTAAGGTTTATATAGTAGAAAGAATAGAGAAGATTTACTAA
GATGGTGTCTTTAACCATCAAAAATTAAAGGTCATAAACAATCACTTGTTCTGTACTTGC
CTAGATTATTTTCACTCTGGTTTGCCATGCTCTCACTAACTTCTTTCTTATGAAAAAATC
ATGTTTGATATGGATGAAAGCTCTAGATGTGAAAGAATCGACAAAATATATGAACAGTTT
GTCCAAGAGTTTAAAATGGTATACGGTTTATTTTCAAAAATGACTGCTAAAATAAATGTA
AACGATTTCAACTTGCAATGTTAGACTGAGGTAAAGAAATAAATTATGGGAAGTTTTGGT
AGATCTCCATTTAAACAGTTCAAAAGCTCTAATAAATCAAGCACAGACAAATTCATGAAA
AAGTTTTAAAATTAAGATGAAACCTAAAAAGAAGAAGTCAAAAACTGTAACGACTAAAAT
GAAATAAAAATTGAAAATGATTAAAACTAAAAACAGCCAATTCAGCCTGGAGAAGGGGAT
TAAGTTCAGATGAAATATGAATTTGGATTTAGAGAAAAATCTAAGATAAAGAAGTTCAAA
GGTGGTAAGAAACCTAGAGATCCAAATGCCCCAAAAAAGGAAAAATTGCAGATAATTAAT
ATAGGCGGTGGAGGCTAAAAGTCTAAAGAGTAAAATGATGAGGAAAAAGGAGCGAAGAAG
AAAAAGTAGCAGGAATATAAAAAGCGAGGTAGAAAAAAGAAAGGCATGTATGACGACGAT
GATGATATTTAAGAACAAAAATAACCTGATGTTACTGAAGTCAAAGTAGTAGAAAAAGTG
AGTTTAGATAACTTACTTAAGAAAGATTCGGTTGAGAAGAAACTCTCGGTGTCTGAGTTG
CTAGCAAAAAAGAAACTTGAATCACCATAGAAAGAAGAAAAGGAACTATTAGAATAAAAT
AAAAGTCCTAAGAAGTCTTCTCCAAGAAAATCAAAGAAAAAAGACATTATTTAGATAGAC
AAAAATCAAGAAAAATAGAACAAACCATCAAAGAAAAAGTCAGTTGAAAGTAAAGAGACA
AAGAAATCAAAACCTAGTAGGAGACGAGAAGAAAAGCTTGACATTAAAATAGTTACTAAA
ATAAAACAAAGATAAGTCAAGGAAGATGTTTTGGATTAGCTTAAAAATAATCAAGAACTT
AAAGATACTTCTGAACCCATCCAATAACTGAAGTCTCCTTAAAAATCTTTACCAAAGAGA
AATTCACCCACCAAATAAGAAAGAGAATCAAGAAATCCTAATGTGGAAGTAATGAGACAT
AGAAGGAGAAACGGAAATGTAGTAATTAAGTTAAGAATCTTAAAAGTGATATTTGAGTCA
AAACTAAAACGAATCCGAGATTAAAATGAGACAGAAACTGAAAACGAAGAAGACGATGAG
CCGTATAATGCTAGTTATTCAAGAAAATCTCCCCCGAAAACTTCTATGAAATCAAAACAA
AAGAAAAGATAAAAACATAGTCCAAATATAGTAGATGCTACTTTTGATTAATAAGCCACT
TTTAACACAGACATTTTCTTAAAAGAGTAGCCAACTTAAATTCAAATAATTGAGAATTAG
AGTTTGATGTCTCAACACAACCTAAATAATTTCGATGCAATTAATAGAAATAATTTTTTG
CTGAACTTATAGCAATATGATCCAAGGAGGAGACATTAATAGCATCAGCAAAACTCAGCT
TTTGGCTATGATGGCAATATTCAAAACATCATAAATCAAGAAGATATAATAATGGATGAA
ATAGAAAATATAAATGAGTTACAGACGGATACAAGAAGCAACCTTGATAATTAAAATAAC
GATTATGAGAATGAAGATTAATCAACATGTCATAATATGGATGATGACAAAATAAGTGTA
CGGTGA


>Contig261.0.g68(protein)
MLQQMLQNYRGMIQELTKIEKKINNIPRLFKGKTINLSNRQVKQPRAIGENKRSRTRDPL
DASRTRSSYPKHINEYARLIAEFQRIKMDEEHKEQQVYFAIEEQLDKAGWYNNIFFKSNS
MHENFMTYRDVVFINKRLAKTRYNRILLVFYGINSNGKSVIFSICFIHKEDEENYEFAIS
NFKKALCDDVNPKIFIIERNSSLKTTIQKQFSNQMRVLFCFDHYQKSIRHYFDNAKGSQQ
KYLSKALQLLEPLPQIEDQRYFESQMDELKKEQQEYANNNDKLFQLLDKIHNERNSWARV
QHLQNFTGAFKVCERNEVIKNFMYHLINRKDTPIEETARILSKSDCIKHPTHCFEEFKLV
KLNQLEEIPFVADYIRENLTNYANNRIRNSIAIGFKDYRITRHDKMTKVYIVERIEKIYQ
DGVFNHQKLKVINNHLFCTCLDYFHSGLPCSHQLLSYEKIMFDMDESSRCERIDKIYEQF
VQEFKMVYGLFSKMTAKINVNDFNLQCQTEVKKQIMGSFGRSPFKQFKSSNKSSTDKFMK
KFQNQDETQKEEVKNCNDQNEIKIENDQNQKQPIQPGEGDQVQMKYEFGFREKSKIKKFK
GGKKPRDPNAPKKEKLQIINIGGGGQKSKEQNDEEKGAKKKKQQEYKKRGRKKKGMYDDD
DDIQEQKQPDVTEVKVVEKVSLDNLLKKDSVEKKLSVSELLAKKKLESPQKEEKELLEQN
KSPKKSSPRKSKKKDIIQIDKNQEKQNKPSKKKSVESKETKKSKPSRRREEKLDIKIVTK
IKQRQVKEDVLDQLKNNQELKDTSEPIQQLKSPQKSLPKRNSPTKQERESRNPNVEVMRH
RRRNGNVVIKLRILKVIFESKLKRIRDQNETETENEEDDEPYNASYSRKSPPKTSMKSKQ
KKRQKHSPNIVDATFDQQATFNTDIFLKEQPTQIQIIENQSLMSQHNLNNFDAINRNNFL
LNLQQYDPRRRHQQHQQNSAFGYDGNIQNIINQEDIIMDEIENINELQTDTRSNLDNQNN
DYENEDQSTCHNMDDDKISVR