Identifiers and Description

Gene Model Identifier

Contig11552.0.g62

Standard Name

MULE6

Aliases

Contig11552_0_g62

Description

MULE transposase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11552.0.g62(coding)
ATGCCCTAGAGTAATATAATATAAGTCCCTCCAGCAGCTCATGATGAATTTTCTGATGAG
GAAAATGTTAACAGTGTTGCAAATCATAATATTGAGGGAAACTACGATTTCAGGGATCCA
GATTTTGATAACTAAGAGTTGACTAGAGACGAGATTAGAAAATAAAATGATCCAAAATTC
ACTTTTAACTTTGGTCATTATCCGAGGCTTTTCAAGTCTGTCTCGGAAGCACTAGATCAT
TACAACAATAAGGGATATCTTGATAAGATTTAATTTAGACTTTATGAACATTAAAGAGGT
GATTTTAATCATAATGGCGAATTGAAAACTCACATGTTTTCGTTGTCTTGTTACTTAAGA
AATTAGCCTAAATATGACACTAAATATTATCAATATGATCAGGGAAGAATGCCAAAGGTT
TCAAATTGTAATGTCAATGTAAGGTTTGAGTGGGATGAGTAAATTGGAAGATTTTAAAGA
GTGGATAAGTTTAAATATGTTCATGACCACAGACTCGAGCTTGATGAAAGATGCCTAATT
GAGAGTTGTATACTTAGAGACATCAAACAACTGGTAATGGACAATATTGAAATTCAAGTT
AGTGAGGTGATTCAAAAAATCTATTAGATACACAATAAAACTCTCAGGCATTTAGATGTA
CTAAACGCTTTGAAACTCATCAAAGGAGATGTAAAACTTGATATTAAATAGCTGACAAGT
GATCTAGAATAAGTAAAGAATAAGCACCCAGACACTTAAATCGCAGTAAACACAGGGACA
CCAGTAGTTGTATTTTTCTAAAGCTAAGATATGCTTGAAACTTACAGACTCTACAGAGAT
GTCATGCTTGTCAGTGTTAGCAAAAAAAGAAAGAATAAGTATGGACTCTTTCAGCTTCAC
ATGACAGGTATAAATAACTTTGGTAGAACAGTGGTGTTTGCGACAGGTTTTACAAACATA
AAATGCAAGGAAGCTTATGAGTGGATTTTTAAGTAATTCAATTAGAGATGTATCTCAAAT
GATATCTAACTTCCAGACGTCTTCATAACAAGTCTTGAGTAGGATATCATAGATGCTAAA
CAAGAAGTTTTCTTTAATTCTAGACATTTAGTATCACAGCATTATTTACTCTTAGCTGCA
AAAGAAGCTTTGAATCCATACAAGAAAAGAATGGATTTTGACTATATCATGGCCCAAGAA
AAATTTGAAAGAATAGTCATAGAAACTGAAATAGACAGATTTAAGCAACTTCAATAAGAA
ATTATGACAATGATTGAAGTTTTAGATGGAAGTTTAAAAACCGAAATATTGAGGATATTT
GATTACTCAGATAAATGGTCCTTAAGATGTATCGATAATTTGTTCACTGCAGGTTTGCAT
TCAAACGAGAGGGCTGCATCAGTAGAGGGATTTTTTAAAACTCAACATAAATACGAACAT
TCAATGATGGAAGTCATGGATCTAGCTAAAAGACTATAGCTGAGGGAATGCTGTTTAGAA
ACTAATTCCAAGGAAGCTCATTCGTACTTTTTGCACCCTGTTTATATACAAATGAAGAAG
AGGTTCAAAAAAAATTAAGTTTTTGAAGTTGAAAGAGATCAAATAACTAAAACCATAAGA
TGCAGGTGTCAATTTTATACACTTAACGATATGATTTGCGCTCACTGTTTTTGCTTAATG
AATGCCTTGTAAATTAAGCATATAAGAAACTTCGAATACATTCAGAGATGGAAAGATGAA
ATTAATCCTGAAGATCCAACTACAAGAGATATGTAGTAAAAGGTAAAACAGCAAAAGAAA
CTCCAGACTTTTATCGACAGAATTGCAGAGAAGAATAGGAATAAGAAAGCAAAGCATAAA
GGAGGTATAGTACCCTTAAGAAGAAAGAAGATCGAAGTGGACTACTATCCTTCAGACGAT
AATGAAGATGGAATGGGTGATCTTGAAGACATTGATGGAGATAGACCAGTAGCTGCAGAT
GGCAGGAAAACAGCTAAAATGTATGACTTAATGGTCCCAGGTAGAATGAAACTCAAAGCA
TTCTCAAGATAAGAAGAGGAAAAACGTAAAAGAATGCACTAATTGGCGAAGTATGGCAGT
GCTTAAGCTATGGAAGACATTTATGATAAGCTCCCCAGTGACCCCCTTTCAATGCCAAAT
ATAGCAGACTTGAACTTTTATTCTGATGGAGATGACTCAAGCGATGCTGCAGGGGATGAA
ATAATAGAAGAGTTTAGAAGAGAATCTTTGAAAGATGAAGAAATAAGGTAAGGCAAACTT
GAGCACTAAAAGTTGAAGGAAGCCGAAAGAGAAGAAAGAAGGAAGCAAAAAAAGAAACAA
GATAAGAAAAAGAAGAAGAAAAACAAATATAGATATCACAGTGCTTAAAAGAAGAAGAAA
TCGAAAAAGAAGAACGATAACTCTAGTCAAAGCGGAAGTTCTAGTGATTCTGATGATAGT
TGCAATGAAGAGAATAAGTCAAACTCTTAAAAAGAGAAAGATAACGAAGCAAATAAACCT
AAGAAGCGATATACTAAAAATGGAATTCCAGTTGTAGAAGTGCCTCAACTTTCAATAAAG
ACCAGGAGAAACGCTAAACAGGATGACGATGCTCCTGCTGCTTAATTAAATAACACATTA
ATAAATTAGCAGAGTAACTCCTAAAATGGACAAGAAAGGGAGAGCAGAAGGCAGGCAGCT
ACCACTTTAAACTCTAATAGCACAAAACCTCTAAATTAAAAAGAAAAAACTTCAGCAGAA
AATGATTAAGATTAAAAAATGGATGAAGTTTTTACATTTTGA


>Contig11552.0.g62(protein)
MPQSNIIQVPPAAHDEFSDEENVNSVANHNIEGNYDFRDPDFDNQELTRDEIRKQNDPKF
TFNFGHYPRLFKSVSEALDHYNNKGYLDKIQFRLYEHQRGDFNHNGELKTHMFSLSCYLR
NQPKYDTKYYQYDQGRMPKVSNCNVNVRFEWDEQIGRFQRVDKFKYVHDHRLELDERCLI
ESCILRDIKQLVMDNIEIQVSEVIQKIYQIHNKTLRHLDVLNALKLIKGDVKLDIKQLTS
DLEQVKNKHPDTQIAVNTGTPVVVFFQSQDMLETYRLYRDVMLVSVSKKRKNKYGLFQLH
MTGINNFGRTVVFATGFTNIKCKEAYEWIFKQFNQRCISNDIQLPDVFITSLEQDIIDAK
QEVFFNSRHLVSQHYLLLAAKEALNPYKKRMDFDYIMAQEKFERIVIETEIDRFKQLQQE
IMTMIEVLDGSLKTEILRIFDYSDKWSLRCIDNLFTAGLHSNERAASVEGFFKTQHKYEH
SMMEVMDLAKRLQLRECCLETNSKEAHSYFLHPVYIQMKKRFKKNQVFEVERDQITKTIR
CRCQFYTLNDMICAHCFCLMNALQIKHIRNFEYIQRWKDEINPEDPTTRDMQQKVKQQKK
LQTFIDRIAEKNRNKKAKHKGGIVPLRRKKIEVDYYPSDDNEDGMGDLEDIDGDRPVAAD
GRKTAKMYDLMVPGRMKLKAFSRQEEEKRKRMHQLAKYGSAQAMEDIYDKLPSDPLSMPN
IADLNFYSDGDDSSDAAGDEIIEEFRRESLKDEEIRQGKLEHQKLKEAEREERRKQKKKQ
DKKKKKKNKYRYHSAQKKKKSKKKNDNSSQSGSSSDSDDSCNEENKSNSQKEKDNEANKP
KKRYTKNGIPVVEVPQLSIKTRRNAKQDDDAPAAQLNNTLINQQSNSQNGQERESRRQAA
TTLNSNSTKPLNQKEKTSAENDQDQKMDEVFTF