Identifiers and Description

Gene Model Identifier

Contig9900.0.g91

Standard Name

MULE5

Aliases

Contig9900_0_g91

Description

MULE transposase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9900.0.g91(coding)
ATGTTCCAAAGAATCCGTATTCACATTTACTTCGACTAAATCTGCAAATCAGAAGTCCTT
GATTTAAATATACCTTTCGAGCAGAATTTCGCAAGAGTGCTTTTAAACTTGGGTATTCCA
TCAAACAACCACTACAAATATGTCATGAAGTTGACAAACGGTGGTGTGGTTGAAAGAAAT
GAAGTGCTCTTTCATGACGACAGAGTAATAATACTAATGAAAGAAGATATCATCCCAATT
ATCAGTCAGCAAGCTTAATAATAGCTCAATAACAGTAATAGTTAGTAGGTTAAGCTAGAG
GGAGTGAGTTAGAGCACAAGTTGCTAAGAAAATTAACCACCATAGCTGTAGCCATAATCA
AATGCTAAAGTTAAGCAAGAAGCTAATCAAGCACAAGCTCTACTTGATGCTATTAACAGT
TTGCACATGAAGGATTTCCACTAGATTTTCAAAACTTACCGTGATTAACATCAAGAAAAA
TTTAATGGATTTAAAAATGAGAGTAATTAAACCACCGCTGGTAAAATTAAGTCAGAAAAA
TCAAAGAAATCTAAACATAGTGCTTTTATCAACTCTGATTCATCAGACTTAAAACATGAG
AGAATTCAATATAAAACTCTATTGAAAAAGAGAATTAAAAAGGATGAAGATGGAGATGAC
AACTAGATAAAAATTGAAGAAAGATTGGATGAATGTAATGGAGGGAGGATGTGGTCAGAT
TGTAACATAGTTCGAAAAATTGATTATGATAACCTTGAAGTGCTGCTCTACAAGAATCAA
ATAAGTGATTATCACTAGTTAATTGATGCTATTAATATGTGGGCTGTAGGCCTTGGTTTC
TTGGTTAAACTTAAAAGATCGCCTAAACTCAATGCTGATGGAAGTTAAACTTTGAGGCTT
TACTGTTAATCATTCAAGAGATCTGAACCTTTAGATACTATTGATGCGCTTTTGTATAAA
GAAAATCCACAGTGTCACTTTGCATTAACTTTTAAGTAAGATGATAAAACTGGATGCTGG
TTAATGTATTAAGAGTACGTAGAGGAATTTATGAAACATAACCATAAATTAGAAAAGCGA
AGATATGATTCTATTAGAGAATATGTGAAAGAATATCATGATAAGGTGAAAACATTATCA
GAGTTAAAAGAACTTATCTATGATAAATTTGGCTTAGAATACACACTAAACTAAATCACT
TATTTTAAGGGGAAATATATTGGAGAAGCTATAGCAGTTGAAAAAGATCATGGCGAAAAC
GAAGCTTTGACTTTACTGAGATTGCTTAAGAAAGGAAATGATGATTATATAGATGTTGAG
TTTGATCCAAACGATAAATCTAATCTACTTTATTTGTTCTATTCATCAGCAAAAATGAAA
GATGCTTATCTCAAGAGCAGTGATGTAGTATTCGTAAACAAAAGGTTTAGCTAGAATAGA
TTTAAAAAGCCAATGGTTATGCTATTTACTGTAAGTAACACTGGAAAAAGTGTATTACTT
GGTTTCGCACTTATTGAGAAAGAAGAGACATTTTATTTTGCTAAGATTGCACAAGGGTTT
TTAAAACAAATGGGCAACAAACATCCACAAACTCTAATTATAGAAAGACAACTTAAATTA
CATCAAGCTTTTAGAGAATAAATGCCTTAAACAAATATATTATTCTGCTATTTTCACATT
TAAAGAACTTTCAAGCAACAGTATTCATTTTTAGAGAGAGAAAATTTGGATTAATATTAG
AAGATTGTTGAACTACCAATAATAGAAAATGAATAAGCTTTTGACATGCAACTTGCTGAA
GTAAATCAATACAGTTTTGCAAATGAGTATTTCAAGCTAATTATATAAAAATTGACTATG
GAAAAGAAGCTTTGGCCTAAATGGTGTCATATGAAATATTTTACTGGTGGTGTGAGTGTT
TGTTAAAGAAATGAGCAAATTAAAACTTATCTAAAACCAGCTTTGAAGAAAAGAGATTGC
ACAGTATCAGAAACATTGAAAAGATTGCTCACGATAGATTAGAAAGAGTTCAAACTGTCA
CATGAATTCTAGAAAGTATCTCCAAAGCATGAGCAAGTATTTAAAGTCGCAAACTTCTTA
AATCATGTTGTAAAAGAATCTTACACTCTATATGCTTACTAAAGAATGAAATGGAATATA
GCAAGAGGCTTTAGATTTGAAATAAAGGAAGAGACACACTCTACTTTTGTCTTGCAGTTA
AAACAATCAAACATAGCTAATAAGAAGCCTTGGCAGCCCACAATGATTATAGTTTAGAAA
GAGTTAGACGAACTCAATCAAAAAATAGGAATCTGCGAGTGCTTGGAGTTTAATCATTCA
GGATTCCCCTGCCCACATCTTTGTCTCTTGAATTACAAAGGAAAACTCATAACAATGCAA
ATTAACAATCGCTGGTTAAAATCTTGTAAAGATAGACAGATAAAAAATGGAGAAAGATCT
CGTCATTAAAGGAAGACTTATGGCGCTCTTGATGATATTGAGAGTCAAGTTATTTCAATA
TCTTGTGAAACTCAAACTCAAAAATTAATGAATGAAACTCAAAGTGTATTCAATCAAAAT
CTTATAACTCAAATTAGTCTAGATAATTACAACCCACAAAAAGTAACTCAGCAGCAAGAT
TTAGACGAAGATGATGATTAAGAAGACTCTCAGCTTTAAAGCATGTCTAGACAGCCAATT
TAAGATTAAATCTACGATCCTACTGGTAGCTTATTGGATGTGAGTTAATTCCTAAGGAAT
CCAACTAAAGAATTGTAGAATAAGAGACAGGTTTCTGAAGAGGATATTTCTCAAGATGAT
AGAATCCCAATCAAAAGGCGTTTTAATAACTAGAAACTGGAGTAATAAGATCACCGAAAT
TCTCAAAGTCAAATGTTACAGTCTATCTCATATAAACTTAATTTAGAGAAAGAAAAGTAA
ATCTAGCTTGAGAATGAAGAAAGCGATGCTGACACAGATGAAGATGACCATGGAGGTTAA
CAAAACAATTAAATTGATTAAGCTGAAGTGGATTCATTAGAGGATGAAAATGATGAAGAA
AGTGAAGATGAAAAAGAAGCATCTTAAACTTAATAATAGAGCAGCACTAGAAATTTTAAT
GGTAAATTAAAGTCATTCATCTTTAATAAAAACAAAAGAACAGTAAAAGCCAGTGAGAAA
TATTTGAAAAATCTTTATAGAATACGGGCTATAAGATCTTGA


>Contig9900.0.g91(protein)
MFQRIRIHIYFDQICKSEVLDLNIPFEQNFARVLLNLGIPSNNHYKYVMKLTNGGVVERN
EVLFHDDRVIILMKEDIIPIISQQAQQQLNNSNSQQVKLEGVSQSTSCQENQPPQLQPQS
NAKVKQEANQAQALLDAINSLHMKDFHQIFKTYRDQHQEKFNGFKNESNQTTAGKIKSEK
SKKSKHSAFINSDSSDLKHERIQYKTLLKKRIKKDEDGDDNQIKIEERLDECNGGRMWSD
CNIVRKIDYDNLEVLLYKNQISDYHQLIDAINMWAVGLGFLVKLKRSPKLNADGSQTLRL
YCQSFKRSEPLDTIDALLYKENPQCHFALTFKQDDKTGCWLMYQEYVEEFMKHNHKLEKR
RYDSIREYVKEYHDKVKTLSELKELIYDKFGLEYTLNQITYFKGKYIGEAIAVEKDHGEN
EALTLLRLLKKGNDDYIDVEFDPNDKSNLLYLFYSSAKMKDAYLKSSDVVFVNKRFSQNR
FKKPMVMLFTVSNTGKSVLLGFALIEKEETFYFAKIAQGFLKQMGNKHPQTLIIERQLKL
HQAFREQMPQTNILFCYFHIQRTFKQQYSFLERENLDQYQKIVELPIIENEQAFDMQLAE
VNQYSFANEYFKLIIQKLTMEKKLWPKWCHMKYFTGGVSVCQRNEQIKTYLKPALKKRDC
TVSETLKRLLTIDQKEFKLSHEFQKVSPKHEQVFKVANFLNHVVKESYTLYAYQRMKWNI
ARGFRFEIKEETHSTFVLQLKQSNIANKKPWQPTMIIVQKELDELNQKIGICECLEFNHS
GFPCPHLCLLNYKGKLITMQINNRWLKSCKDRQIKNGERSRHQRKTYGALDDIESQVISI
SCETQTQKLMNETQSVFNQNLITQISLDNYNPQKVTQQQDLDEDDDQEDSQLQSMSRQPI
QDQIYDPTGSLLDVSQFLRNPTKELQNKRQVSEEDISQDDRIPIKRRFNNQKLEQQDHRN
SQSQMLQSISYKLNLEKEKQIQLENEESDADTDEDDHGGQQNNQIDQAEVDSLEDENDEE
SEDEKEASQTQQQSSTRNFNGKLKSFIFNKNKRTVKASEKYLKNLYRIRAIRS