Identifiers and Description

Gene Model Identifier

Contig6092.0.g26

Standard Name

MULE4

Aliases

Contig6092_0_g26

Description

MULE transposase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6092.0.g26(coding)
ATGTTAACCAATACGAAATACTCGATAAGATATTAAGTATATTACTTTTTACCTGTCGCT
GCTTAAAATTGCAAAAATGGAACTTCAACATGGCCAGGAAATAGTAGTAACTTTTCTAAT
TTGGCTTTGTTGGACTACACAACTCTCTTCACAGATAAACTAAAGAAAACTCAATTGAGT
TTAGACAAGTCCAAGTCCCTCCAGTATAACATGAAAAAGTGGGTTCATCGCTTAAAAATT
TAAAACACGGAAAACCAACCACATAATTGTGAGCTAATAGTGTAATTATGGAGAATATCA
GACGATATGAATTCCATTATTCATAATAAAGAGTTCTCCTAGGAAGAATTACTGTTCATA
GGACTAGAGGAATAACTTGAAATGTTTAAGGAGAAATTAAGTGCCAAAGAAATCTAAGAT
ATTTTAGGGGATGATGGAGAGACAGAGGAAAAAGTCAGCGTGGAAAAATCTGATTAAAAA
CAGGAGAAAACCTTGACTAAGAAATAACTAGAAAAGTTACAGAAAGCTCAAAAGATTGAG
GAGAAGAAGCTACTTAAGTCTATGTAACTGCAATAGAATTATCAATTAAACAAGGAAAGT
ATGCAAGCTCATCAGGAGAAAACTTCAGAGATAGCTATGAATGAAGATTGCTTTGAAGAT
ATCATTAGTTTGAGATCAGAAGATTCCATAATAGAAGTCAAACCCTCTAAAAGACAACGA
AAATCATCGATGAGTAATGACTCTGTAGATGAGAACGATTTCGATGAGCTAGCTTTTTCT
TAAGATAATTTAGCAAGCAATTAGTAAACATTAGATGATCCAGACGGTTCAAAGAAGTTT
AAAGAAAAATAACAGAGATAAAGGAAGTCAAATATTGGTCAAAAATAAGTTATAGGCACC
ACTGCTAAATAGCAATAATAGTAGAAGATATTCATGTCAACTAAAATAGAAAATGAAAAA
CCCTATGATTTTTCAAATTTTTCAAGAAACCTGAATGAACTCACAGACGCTAATATAGTG
CAGATATAAAAATATCTAGCTCATAACCAAATTCTGGATTTCAGGCTTCTCGTCTCATAG
TTAAACTCTGAAATCTTTGAAATTTTCAAGAAATTTACAATTTCAATTGACAAAGTGCCA
GATTTAAGGGATGATGGTTAATAAGAAATGATTTTAAGATGTCTTAGACATCATTAATAG
ATGAGTGATAAAAATGCTAAAGAAAGTAAAGGGGATGCCAATAAGTAGAGCAATAATAAT
CATAGCGAGGATGATGATTTTTTCGATGCTATTAAAAACATAGGGTAAACATGCTTGTGT
CCTCTTACATTGCTTTTCAAAACCACAGTGGAAGGCTTTTGGCAACTAGAAAAAGAAGCA
ACAAACCTGTATATTCATGATCCTTTAATGCACGCTCTCTAACATGAAACAATCATGAAA
AAGAGATAGATGAAAAGCATCTAGTCAAAGAAGTTTGATGAGTTTCTAAACCAAAAGAAC
AACAATGAATTGGAATTATTTAACAAGCCAGACTTCGAGGATGAGTTCAACACAGATAAC
TTGAGCAATTTGTAGTATGTCAACTCTAAGTTAAAGAAAAATGGGAAAAACATTGTTGAA
TATGAAGACGCTGATCAGGGAAGTACTAAACTTTCGATAAGTCCTAGTACAGACTAATAA
GTAAACGAGACTGACTAAGAAAACAATAATAACAATTATAGCATACTTAACGATGGATTT
TTCAATTCCCCTTTAAAACAAGAAATATAGCAAATTTAGCAAAATGTGCCATAATTTTAG
GCACAAAAGTAGTCAGTTCCATAAAGACCTGTTAGATAGTTGACAATAGGAACAGTTTAA
GTGGCACAAAACGTGCTAGTAAATGTTATGGATTCATCACAATTCTTGAATTAAATGGTA
ACTGAAACTTTACCAGCAGCTAATAGTAATTCTATGTAATAAAATAAATTTGATAAACTC
AACAACAAGAAGAATATCTTTTAAAAAAGATAAATTTAACTAGAAAACTCGACATTTTAA
GAATAGTAAGCCAGCATTGAAACAAAAGAAATTCCTAGTTCCAATTAAATTCTAATTCAT
CAAGACTCATCTAAAAGTGACTAGATGAGATAAATCAATACCCCGAAACCCCTTAACAGT
GACATCTCTTGGTTTGTCAATGAAGAAGATAGATATTTCAAGGGTTAAGACTACAAAACC
AAATACGAAGATACTCATAAACTGATAAAATATTTGAAGACAAATTACGGAAAGAACGAT
TTTTATAGATACGAAACCGATTCAAAAAATGAATGTCTAGTAAAGACAATTGTAATCATT
ACTGAATAGATGAAGGAGAAGTACCTAACTTACAATGACATATTGATTATCTGCCCTTGC
TATTAATCATTTCAAGAAAATAGATTTAACATGCTAGGTTTGACATTTTATGGGGTAAAT
TCAAATGGTAGAAACATAGTCTTTGGATTTGCTTTAGTCACCATAAACGATCCATCAAGT
ATTGAATATGCTGTTAAGAACTTCCTTTTTTATATGATTTAGCTACCAAAAGTTATATTA
ACTGATCGAAATCATTTCAAGCCAAAAGAATTTGAAAAACCTAGATTACTTTATTGCAAT
CACTCCATACTTCGAGATCTGAGTATGAAATATGATTTCTTGAAGCAAGATGAACCTTAG
CTCTATCATCTGTATCTCAGCTTGCCTATGATTGAAAATAAAGAAGAATTCGATGAGAAA
ATTACAGAGCTGCAGAAAATTAAGTTTAACTAAGTAGAAAACCTATGTCACTATATGCAA
AAGCTTGCTAAAGACAAGCATCTATGGTCAACTGCTTATAGGCTACCTGTTAATAGCAGT
ACTCGTTAAAAGTGTAGAACTGCTGATATATCATTAAGTTAAAGAAATTAATCCATAGAA
GGATACATAAGCAACTTAATAGATAGATCTATAGATTTTTCACCAAAGGAATTTTTCAGA
CAACTAATATGCATCGAGGAATTTGAGTTTGGATATTCTAATGAATCTAAAGTAATTAAT
CAAAGCCTATCCTAAAAGCTTGAACTGTCTAACTATTATAAGGATCACATTCTCTAAAAC
TATACAACATATTTTCAGTAGAGATTTAAATACTAAATAAATAAATCAGGATCTTACAGA
TGTCAATAAAATAACAGTTAGCAAGGTATTTTAGGTTAAGAAAGTATGACTTAATAATGG
AACGTGGGTTGTTAGGATAAGTTATCATTTAAAGTTAGCTTGCAAACAAAAATTAAAAAC
TAGAAAAGACTCAGTTATTTACTCTGTGAATGTGGATTTAGCTAGATTTCAGGTATTCCT
TGCTCTCACGAATATTGGGTTCAAAATATGTTTTATTCAGATTTCTTTGAAAACTAAAAC
TATCTTATGATCAGCAAAAGGTGGCACCTTAACTATGAAAAAGCAAAATAAAACGAACTA
TATGAGAAAGATACTGGGATAATGCAACTTCATAAATCAATAAATTATACAAATTCTACA
TCTATTGAACTTAAACCTCAAGTAGCTTCAAAGAAAAAGAAGAGTGTTTAAAAAAAGAAA
AAGAGATCTTAAACTCCTGAATCTCTATCCTAATGTACTTAAAATGATAACTTGCTCTAG
TTAAAACCAGTTGAGCACTAATATTAAACTCGACATTCTGAAAGATTAGAGGATATGAAA
ATTGAATAAGAATATCCTTCGACATAATAAATGGAATGTGTAATATCTGTAGATAAGGAT
ATGCCAATATTTACAGAAGAAAGCTGA


>Contig6092.0.g26(protein)
MLTNTKYSIRYQVYYFLPVAAQNCKNGTSTWPGNSSNFSNLALLDYTTLFTDKLKKTQLS
LDKSKSLQYNMKKWVHRLKIQNTENQPHNCELIVQLWRISDDMNSIIHNKEFSQEELLFI
GLEEQLEMFKEKLSAKEIQDILGDDGETEEKVSVEKSDQKQEKTLTKKQLEKLQKAQKIE
EKKLLKSMQLQQNYQLNKESMQAHQEKTSEIAMNEDCFEDIISLRSEDSIIEVKPSKRQR
KSSMSNDSVDENDFDELAFSQDNLASNQQTLDDPDGSKKFKEKQQRQRKSNIGQKQVIGT
TAKQQQQQKIFMSTKIENEKPYDFSNFSRNLNELTDANIVQIQKYLAHNQILDFRLLVSQ
LNSEIFEIFKKFTISIDKVPDLRDDGQQEMILRCLRHHQQMSDKNAKESKGDANKQSNNN
HSEDDDFFDAIKNIGQTCLCPLTLLFKTTVEGFWQLEKEATNLYIHDPLMHALQHETIMK
KRQMKSIQSKKFDEFLNQKNNNELELFNKPDFEDEFNTDNLSNLQYVNSKLKKNGKNIVE
YEDADQGSTKLSISPSTDQQVNETDQENNNNNYSILNDGFFNSPLKQEIQQIQQNVPQFQ
AQKQSVPQRPVRQLTIGTVQVAQNVLVNVMDSSQFLNQMVTETLPAANSNSMQQNKFDKL
NNKKNIFQKRQIQLENSTFQEQQASIETKEIPSSNQILIHQDSSKSDQMRQINTPKPLNS
DISWFVNEEDRYFKGQDYKTKYEDTHKLIKYLKTNYGKNDFYRYETDSKNECLVKTIVII
TEQMKEKYLTYNDILIICPCYQSFQENRFNMLGLTFYGVNSNGRNIVFGFALVTINDPSS
IEYAVKNFLFYMIQLPKVILTDRNHFKPKEFEKPRLLYCNHSILRDLSMKYDFLKQDEPQ
LYHLYLSLPMIENKEEFDEKITELQKIKFNQVENLCHYMQKLAKDKHLWSTAYRLPVNSS
TRQKCRTADISLSQRNQSIEGYISNLIDRSIDFSPKEFFRQLICIEEFEFGYSNESKVIN
QSLSQKLELSNYYKDHILQNYTTYFQQRFKYQINKSGSYRCQQNNSQQGILGQESMTQQW
NVGCQDKLSFKVSLQTKIKNQKRLSYLLCECGFSQISGIPCSHEYWVQNMFYSDFFENQN
YLMISKRWHLNYEKAKQNELYEKDTGIMQLHKSINYTNSTSIELKPQVASKKKKSVQKKK
KRSQTPESLSQCTQNDNLLQLKPVEHQYQTRHSERLEDMKIEQEYPSTQQMECVISVDKD
MPIFTEES