Identifiers and Description

Gene Model Identifier

Contig414.1.g103

Standard Name

MULE2

Aliases

Contig414_1_g103

Description

MULE transposase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig414.1.g103(coding)
ATGCTTACGAGTTAGAGGAGGATAAATAGAAATTACCAACCACACAGCTTAAACTTGAAC
ATGCGATAGAACTATCATAGATTTCATGAGGTCCTATTCATAGATTCAACAATCAAACAT
CGAAGTGGAATCTTAGAACCTTTAATCGACAGATTTTAAAGTGTTAATAACACAAGTAAT
GGGAAGTAAAACAATGGACAGCCTTCCGCAGATGGCTCAACAAAGATTGACAATGCATTA
GAAATGAATTTAGTACTGCTAAGTGGCATAAACAATGAAGGCAAAAATGTTTTATTTGGG
TTTGGACTCATAAAAATACCTGATGTAAGAAGCATTAGATGGATCCTCAAAAGATTTATG
GAATTTAGTAAACATGAGTTAAGAGGGAAAATTTATCCAACAACTGTCATTAATCCCTAC
GACTAATGTCTAAATGAAGCTGTGGATAGAACATTTAGTATGAAAACTAAGTAAATTTTA
CTTTGCTAAAATAGCATTAAAAGATAGCTATAGATTAACTTCTCTCAACTATCTTCAAAA
AAAGAATTATCAACCAAGCAAATCTATAATCATTTGAAAGATGTGGTTTTTACAGATGAC
CCAGATAACTTTCTTAAACTTCAAGAAATTATCTTTAGTATTGGATAAGAAGTACTTGAG
CCAGAAATGTTAATTAAGTTGAAACAAATTTTCCAGACTAAAGACAAATGGGCTTCTGCT
TTTATTTAAAGACAAATCTTCTCTTGTGATATACATTGTCTGGCTAGAGCAGAAGCAGTT
CATCATTTAATAACTTCAAATCTATACTGTAAAGCTACTCTAATTGAATTGATAAAATTG
ATAGAAGATGTAGATAGCAAGATAGAATAGAGATGCTAGTAAACTGCTCAATAAGGATCG
TTTAAACAAATCACCCACCATCCCATGTTAAGATAATTAAATACTATGTTCACTAAGTTT
GCCTATGAGCATATGCTCTATCAATTTATGCTTAGTCATCAAGGGAGATTGATATCATTT
CAAAGAACTTTTGAGAATGGCTACAGTGGAGACTACATAGTGAAAGAATGGATATCTCCT
ATGTGGGCCGAATTCAAAGTGAAACTTATTTTCAACTAGGCTACACTAAGCTCAAATCAT
TCAACTTCAGAGTCTCACTCACAACCCAGTGTCTAAGCTATAAGTAACCCCTCAACCCCA
ACTAAAAGTGACTAAAAACCTTTGTACATACCACCATACGTTAATTAAAATCAGCTACTA
GCTGAATGCTACTGCAACTGCGATTACTATCACTCCTTCAACCTGATTTGCTAACATATT
TTCACAGTTTTTAACGTCTTGCAAGTTAAACGAATAGGTAGATCCTATAGATTATTCAGC
AGGTGGTTACGTTAAGCCGAACATGATGATTATTTTAATGAAAATATAACAATTCTTAAT
CCTTATGAAATAAAAATGACTGAAAAAGAGCGAAAAAGCTTTCTAAATCAAAATACAGCT
GGGATAATATAATCGATGGGCTATAACAGTGCTGGAGAGAGAATTTTTGGGTATACTGAT
TAGCGATATAATAGAGGTTCTGGGATTTAGATGGATGGATAATTAATCAATAAACAAATT
AACTTGATTATCAATTGA


>Contig414.1.g103(protein)
MLTSQRRINRNYQPHSLNLNMRQNYHRFHEVLFIDSTIKHRSGILEPLIDRFQSVNNTSN
GKQNNGQPSADGSTKIDNALEMNLVLLSGINNEGKNVLFGFGLIKIPDVRSIRWILKRFM
EFSKHELRGKIYPTTVINPYDQCLNEAVDRTFSMKTKQILLCQNSIKRQLQINFSQLSSK
KELSTKQIYNHLKDVVFTDDPDNFLKLQEIIFSIGQEVLEPEMLIKLKQIFQTKDKWASA
FIQRQIFSCDIHCLARAEAVHHLITSNLYCKATLIELIKLIEDVDSKIEQRCQQTAQQGS
FKQITHHPMLRQLNTMFTKFAYEHMLYQFMLSHQGRLISFQRTFENGYSGDYIVKEWISP
MWAEFKVKLIFNQATLSSNHSTSESHSQPSVQAISNPSTPTKSDQKPLYIPPYVNQNQLL
AECYCNCDYYHSFNLICQHIFTVFNVLQVKRIGRSYRLFSRWLRQAEHDDYFNENITILN
PYEIKMTEKERKSFLNQNTAGIIQSMGYNSAGERIFGYTDQRYNRGSGIQMDGQLINKQI
NLIIN