Identifiers and Description

Gene Model Identifier

Contig14154.0.g51

Standard Name

MULE1

Aliases

Contig14154_0_g51

Description

MULE transposase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14154.0.g51(coding)
ATGTTTGAGGAAGACAGTATTGGAGATAAAACTCATAATTAAGACTATGAAATTCTATTC
GAATCTGATTTTGAGGGATTAATGCTAAAAGGCCCAGATATAGATGACATATTCATAAAA
TACAACGATTATGCAAAGGATCATGGATTTAAAATGAGAAAATCAAACAGAAAAAGCGAT
AAACATTCAGCCTCTTTCAAAGCCTATGAGTTTTGCTACTTCAATTGTTAGTTTGGACAC
ACAAAAGTTTTCGAAAAACATGGTGGTTATAGGAAAACTCAATGGAAAAATGAGCTGTAT
TAGAAAGGCAGTGCTAAGACCAATCCTTGTAAAGCGAAGGTTATATTCGAAAAAGACCCA
ATCGAAGAGTAGTGGTACTTGAAAGAAATTACGGCTGGGCATAATCACGACCCTGATCCA
ACTCTTTTATCAAATGAAATAGTATTCTATATTGATGAGTTCGTGACTAGTGTGGGATGC
AAGATACAAGCTATGGATATAGTTAGTCATTTGAGATAAAGATTTTAAAGAGATTTCGAT
ATACCAACACTACTGCATCATTTGAGTTAACGATTCGACATAGTTCATAAAGCTGAGAAT
GTAGAATTTGCAAAAGAGTTAGTCAAGGAATTTCCAAATGAAATTATAGATGCAGTATTT
GATGAATACGAACTCAAACGTATCATAATTTGCAGTGAGGAAATGCAAAAAAGATATCAG
CAATATGGTGGATTTGTATTGATGATTGACAATTTATACTCTAAATTCGTAGAAGACTAT
TCACTTATGCTAACTGGGATAAATCAAGATGGTGAACATTAAGTATTTGCGGTGATTATT
TGTTAAAAATCAGTTGACTCACTGAAATTGTGCTTTAATAAGTTTCTTGAGTTGAATGGT
CGATAAATAATGCCTTAAACTATAATCATAGATTCAGATCCATATATCTTAGGTGTATGC
CAAGAAATTTTTCGATAAAGTAATGTCCAGCTTAGTCTTTATCACATCTTAAAAAGAACA
AAGAAGATTTTTGAAGGATCATCTCATCTAAGCAAAGCTGTTGAGTTAGTAACAACAGAT
TTGTTTATTAAGAATTACATAGACTTCACTTATGGACCAATAGAACCAGCTTTGACTTAC
GATTAAAGTAATCTTTTGCTCTTTTTACATGATAAGAAAGATCTTTGGTAAGGGCTATAT
CAAAAGAAATCTGTTCAACATTTAGGAATGAATACAAACATGAGATATAAAAATCATGAT
TCATATAAAAAGATTTACAAGTCTCTTAATTAGCAAAAATGCTCAGCAAAAATATTTATG
CAAGCCTTAGAGTTTTATTAAGGAAGCTAAACAAATAGTATCAATTTAAATCGAGATTAA
TTTTGGTTCAAGAATTATCAAGCTTTTGTATCAGCAAATGTTACTACATTACTACCAACT
GGCTTTATAAATATGATCTAAAAATCTAAGATTTAGCATTCAAAATTAGCTATACTTTAT
CTCTTCAAGGAATACTATGAATCGTTAAGATGGAAGATTGACTTACAAACAAATATTGAC
ATAAACAAACCAGAAGCTATAAAATCACTTTCAAGTTTTAAAGTTATACCTATGAAACAA
ATGCAAATTTCTAAATATTCCACAAACTCTCTTGATGATGAAATTGAAAAAGTGAAGCAA
AGAAACTTGCTTTGCCCTACATTGCAACATAAAATTGTATAATAAGATGAAGAAGAATTT
GAAACGATTAATCTTTAAAATCCTTAGAGTTTACAAAATGTCTTAATTACTTGCTCGTGC
TTTTACTAGAATGAATATGGAGGCTTGCCATGCAGACACAAAATCAAATTTATGAGTGAG
ATAGGCAATAGAATTCTAGGTATAGATTATATGCAGTTAATTAGTCATCTTAATTAGATT
TGGCTCAGTGGAGAATCTAAGCAAATGAAACCATTATCAAGCTTAAATGGAAATGACTCA
AAAAGTTTTATAAGTAATTTTAACACTAGTTTGACGCAATTGATACAATCTTCAAATAAC
TTTAGATTAAATCCTGAAACTACTACGTCTACCTTAAATTAATGA


>Contig14154.0.g51(protein)
MFEEDSIGDKTHNQDYEILFESDFEGLMLKGPDIDDIFIKYNDYAKDHGFKMRKSNRKSD
KHSASFKAYEFCYFNCQFGHTKVFEKHGGYRKTQWKNELYQKGSAKTNPCKAKVIFEKDP
IEEQWYLKEITAGHNHDPDPTLLSNEIVFYIDEFVTSVGCKIQAMDIVSHLRQRFQRDFD
IPTLLHHLSQRFDIVHKAENVEFAKELVKEFPNEIIDAVFDEYELKRIIICSEEMQKRYQ
QYGGFVLMIDNLYSKFVEDYSLMLTGINQDGEHQVFAVIICQKSVDSLKLCFNKFLELNG
RQIMPQTIIIDSDPYILGVCQEIFRQSNVQLSLYHILKRTKKIFEGSSHLSKAVELVTTD
LFIKNYIDFTYGPIEPALTYDQSNLLLFLHDKKDLWQGLYQKKSVQHLGMNTNMRYKNHD
SYKKIYKSLNQQKCSAKIFMQALEFYQGSQTNSINLNRDQFWFKNYQAFVSANVTTLLPT
GFINMIQKSKIQHSKLAILYLFKEYYESLRWKIDLQTNIDINKPEAIKSLSSFKVIPMKQ
MQISKYSTNSLDDEIEKVKQRNLLCPTLQHKIVQQDEEEFETINLQNPQSLQNVLITCSC
FYQNEYGGLPCRHKIKFMSEIGNRILGIDYMQLISHLNQIWLSGESKQMKPLSSLNGNDS
KSFISNFNTSLTQLIQSSNNFRLNPETTTSTLNQ