Identifiers and Description

Gene Model Identifier

Contig20615.0.g33

Standard Name

MTRF1L

Aliases

Contig20615_0_g33

Description

RF-1 domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000117303.001096210761825e-82Peptidyl-tRNA hydrolase domain
containing pro...
SGDYGL143C2.9997246065828143e-59MRF1 SGDID:S000003111, Chr VII
from 235958-234717, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20615.0.g33(coding)
ATGCACAGTATCTTAAAAGATCTTAAGAGTTGTACTGATATCATGAATGATCCAGCAGAG
GATAAGGAAATGCGAGAATTTGCTAAGGAAGATTATGAGAGTATTATTGAAAGCTTAGAT
GAATTACAAGAATAGATTGAAGATGAAATTGTTCCAAAGAGAGAAGTTGATGCAAAGAAT
TGCACAATTGAAATAAGATAAGCTGCAGGAGGAAGTGAGAGCAGTTTATTTGCAGAGGAT
CTAGTTAACATGTACAAACAATACGCCTAGAATAAAGGATTTAAATGCGTAGAAGAGGAA
TTTACACAAGATTTAGCCATCGGTAAGGGCTGCAAACACGCTGTTTACAAGATAATTGGG
ACAGACTCATATAAATACTTCAAGCATGAATCAGGTGTTCACAAAGTCCAAAGAGTGCCG
GAAACTGAAAAGGCAGGAAGAATGCACTCAAGTACAGTTACAATGATTGTGATACCTGAA
ATCCCCAAGGAATTTCATTTAGATGAAAAAGATATTAGAATTGATACTTATAGAGCTGGT
GGTGCAGGAGGACAGCATGTTAACAAAACTGATAGTGCAGTGAGAGCTACTCACTTACCA
ACTGGTATTATTTGTTAATGTCAGGATGAAAGAACCTAACATTCTAATAAGGCCAGAGCT
TTAGATTTCTTAGAAGAAGAGCAAATGAAAGAAAAGAAATAGAAAAAAGAGCAGATGGGT
TCTGGAAATTTAGACTCTAAGATTAGAACATATAACTGGCCAAGTAATAGAATAACAGAT
CACAGATTAGGAGTATCAAAGTATGGAATTGAGTAAATGCTCACTGGAGAATTGCTTGAA
GAGTTTATCGATGAATTATTAGAAATGGAAAGAACTCAGAGCATCAAAGATCTATTTGGA
GAAGATGCAATGGATGGTAAAAAATCTGCATCATGA


>Contig20615.0.g33(protein)
MHSILKDLKSCTDIMNDPAEDKEMREFAKEDYESIIESLDELQEQIEDEIVPKREVDAKN
CTIEIRQAAGGSESSLFAEDLVNMYKQYAQNKGFKCVEEEFTQDLAIGKGCKHAVYKIIG
TDSYKYFKHESGVHKVQRVPETEKAGRMHSSTVTMIVIPEIPKEFHLDEKDIRIDTYRAG
GAGGQHVNKTDSAVRATHLPTGIICQCQDERTQHSNKARALDFLEEEQMKEKKQKKEQMG
SGNLDSKIRTYNWPSNRITDHRLGVSKYGIEQMLTGELLEEFIDELLEMERTQSIKDLFG
EDAMDGKKSAS