Identifiers and Description

Gene Model Identifier

Contig15654.0.g76

Standard Name

MTO1b

Aliases

Contig15654_0_g76

Description

Glucose inhibited division protein A

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

  • flavin adenine dinucleotide binding (IEA) | GO:0050660
  • electron transfer activity (IEA) | GO:0009055
  • oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (IEA) | GO:0016705
  • oxidoreductase activity (IEA) | GO:0016491

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002954009.997093137033517e-262glucose-inhibited division pro
tein A containi...
SGDYGL236C4.998065322133077e-171MTO1 SGDID:S000003205, Chr VII
from 55796-53787, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15654.0.g76(coding)
ATGAATTAGACTATATAGAAATAGAATTATTCTATAATAAATAGTGGTGCTAGGGATGCT
TAAGTCATAGTAGTTGGTGGTGGTCATGCTGGATGTGAAGCTGCATCTGCTTCAGCCAGA
ACTGGTGCGAAAACTCTTCTAGTGACACAGAAACTAAGTACTATAGGTGAAATGTCTTGT
AATCCTTCAATTGGAGGAGTAGGAAGAGGAACTTTAATTAGAGAAATAGATGCTATGGGT
GGTGTGATAGGTAAATGTGCAGATCTCTCTGGAATTCAATTCAAAGTTTTGAATCGTAGT
AAGGGTCCCGCAGTTTATGGACCACGTGCATAAATTGATAGAGACTTATACGCTAAAAAC
ATGCAAAGAATCATCACTGAAGAAACTTAAAACTTAGAAGTGTATCTGGGTAGTGTACAT
GACCTGATTATTGAGGATGGGGAATGTCGAGGAATAGTCTTGGAAAACGGAGAGAAACTA
CGAGCTTCAAATGTTATACTGACTACTGGCACGTTTTTAGGGGGTCGATGTTACATAGGG
TAGAAATAAATATCTGCTGGAAGGTTTATGAGAAATGAAGAGGGTGTTGAGAAAGCTAGT
GATGGATTGGCTTATTCTTTGAGGAAGATGTTCCCCATTGATAGATTGAGAACGGGTACA
CCACCTAGATTAGATGGGAAGACAATTAACTATAGAGGAATGGAAATATAAGAAAGTGAT
GAGAAAATTTAGTTCTTCAGCTATGTTCATGAATTCAATCAAATTCAACCAGTTAATCCA
CAGATATAATGCCATATAACTAGGACAAATGAATATGCACATTAGGTAATTAGAGATAAT
TTACATTTGACTGCTAAGTTATCACGTGGTGGGGGTTACGGTGTAGGACCCAGATATTGC
CCATCTATCGAGAAAAAGTTAGAAAGATTTCCAGACAGAGATGGCCACAATATTTGGCTT
GAACCTGAAGGTTTATCAACAGATGTTGTTTATCCTAATGGTATAAGCACAGGAGTTCCC
GAGGAAGCTCAACTAGAGTTTCTACGACGTATTCCTGGCCTTGAAAATGTGAAAATGGTA
AAGCCAGCATACATAGTGGACTATGATTACATAGATCCTAAAACAGTGCTGAAACACACT
CTTGAGACTAATTAAATACCTGGACTGTTTTTAGCAGGATAGATTAATGGAACTACTGGA
TATGAAGAGGCAGCTTGTCAGGGACTAATAGCAGGCATTAACGGAGGGAGAAAAGCCTAA
AATCTATCACCATTCACGCTATAGAGAGATGAGGCATTAACTGGAGTGTTAGTAGATGAT
CTAATAAAGGATGGTGCTGACGAGCCTTATCGAATGTTTACTGCAAGATCAGAATATAGG
CTGTCAGTAAGAGCGGAAAATAGTGATTTCAGACTCACTCCAAAGGCTATTGAATTAGGG
ATTTTAAGTGCAGAGTAGGCTATGATATTCGCAAAGAAAGAGGAACTCAAGGAAAAAGCA
AATTCATTTCTAATGAGTTATTAACTTCCAAGCTTCAAATGGTATGCTCGAGGCATTAAA
CCAGCCTCTTCAAGTAAATGTGATTTAGTATCTGCTCACAAGATACTTGGCTACCCAGGC
ATAAAACCAGAGGAGGCTTAGAACGCTTGGTAGATTGATTAAACCGAAGAAGAGAAATTT
GAGATTGATAGTAGAATAATTGATCACGTTTATGTTGAGAGTTAATACAGTCATTACATA
TAACAGCAATAAAAAATGTCAGCTCATAATAAGAAATATGCTTATGACGAGGCTATTGCA
CAATAAAACATTAAAAATAGCACAAGATCTATAATTAAAGACATTAAAAGTACTAAAGAA
CAATGA


>Contig15654.0.g76(protein)
MNQTIQKQNYSIINSGARDAQVIVVGGGHAGCEAASASARTGAKTLLVTQKLSTIGEMSC
NPSIGGVGRGTLIREIDAMGGVIGKCADLSGIQFKVLNRSKGPAVYGPRAQIDRDLYAKN
MQRIITEETQNLEVYLGSVHDLIIEDGECRGIVLENGEKLRASNVILTTGTFLGGRCYIG
QKQISAGRFMRNEEGVEKASDGLAYSLRKMFPIDRLRTGTPPRLDGKTINYRGMEIQESD
EKIQFFSYVHEFNQIQPVNPQIQCHITRTNEYAHQVIRDNLHLTAKLSRGGGYGVGPRYC
PSIEKKLERFPDRDGHNIWLEPEGLSTDVVYPNGISTGVPEEAQLEFLRRIPGLENVKMV
KPAYIVDYDYIDPKTVLKHTLETNQIPGLFLAGQINGTTGYEEAACQGLIAGINGGRKAQ
NLSPFTLQRDEALTGVLVDDLIKDGADEPYRMFTARSEYRLSVRAENSDFRLTPKAIELG
ILSAEQAMIFAKKEELKEKANSFLMSYQLPSFKWYARGIKPASSSKCDLVSAHKILGYPG
IKPEEAQNAWQIDQTEEEKFEIDSRIIDHVYVESQYSHYIQQQQKMSAHNKKYAYDEAIA
QQNIKNSTRSIIKDIKSTKEQ