Identifiers and Description

Gene Model Identifier

Contig17818.0.g40

Standard Name

MTIF2

Aliases

Contig17818_0_g40

Description

Elongation factor Tu GTP binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00009 ) Elongation factor Tu GTP binding domain
  • ( pfam11987 ) Translation-initiation factor 2
  • ( pfam01926 ) 50S ribosome-binding GTPase
  • ( pfam00071 ) Ras family
  • ( pfam08477 ) Miro-like protein
  • ( pfam02421 ) Ferrous iron transport protein B
  • ( pfam03144 ) Elongation factor Tu domain 2
  • ( pfam10662 ) Ethanolamine utilisation - propanediol utilisation
  • ( pfam13476 ) AAA domain
  • ( pfam13555 ) P-loop containing region of AAA domain
  • ( pfam02671 ) Paired amphipathic helix repeat
  • ( pfam02919 ) Eukaryotic DNA topoisomerase I, DNA binding fragment

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011194709.001992589090134e-64Elongation factor Tu GTP bindi
ng domain conta...
SGDYOL023W4.997860539111522e-53IFM1 SGDID:S000005383, Chr XV
from 278056-280086, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17818.0.g40(coding)
ATGGACTCACATGAGATTCTTAAAAGAATTGAAATTATAAGCAATGACACAATTATCGAT
GAGTTCACTGATCTTCCTGTTGAGTTGATAGAGACCCTAGCTGTAGAATATGAAAAAGAG
GTAGAAATAATTAAAGACGATAAGGCAAGAGCATAATTTAAAGAAAGACCTCCAGTAATT
ACTATAATGGGACATGTCGATCACGGAAAAACTACTTTATTAGATGCTTTCAGACATTCT
CAAAAGGTTAAGGAAGAATATGGCGATATTACTTAAGCTATAGGTGCATTCACATTCGTG
ACTGATAGTGAGCATGAAATTACATTTATCGACACACCAGGGCATGAGGCTTTCTAAAAC
CTTCGACTTCGTGGTGCTAAAACTACAGACATGATTATTCTGGTTATCTCTGCTATAGAA
TCAATACAGCCTTAGACTATTGAAGTCATTCAAATTTCTCAAAAACTTAAGATCCCTGTT
ATTGTTGCTATCAATAAAATTGACAGAAACTCAGCAGACCCAGATGCAGTGATGTTAGAC
CTCGCTACATATGATATGATAGCTGAAGAACTCGGTGGTGACTTGGTCTGTGTTCCCATC
TCAGCCAAATAGAAAACCAATTTGGATTTACTAGAATAGAAGATAGTCGAGGTCGCTCAT
AGCAGAGTAGATTTAATGGAAGATTTTGGTTGCAGAGCACAGTGCTATATTATTGAATCA
AATTTTGATGAGAAATCAACTTAAGTTACAGCAACAGTGTTGGTGAAGAAAGGCACTTTA
AATTAAGATGATATTTTTGTCTGTGGCCCACATGAAGGAAAAGTTAGATTTATGCGTAAT
GACCAAGGAAAGAATGTTAAATCAGCATATCCTGGGTAAGCAGTGCATTTGGCTGGATTC
AAGAGTTTTCCAGAAGTAGGTTTACCTCTATACGCTTGCAAAAATCATGAAGAGGCTCAG
TTTATGGCAAACAGAATTTAAACAAGGAGAGACAAAGAAGAACAGATGAAGTTGTTTGAT
GATTAATTAGCTAGTGAAGGACTGGACATGAAGAAGAAAATCAAGGGTCTCACCAGAATG
GAAAAGCGTAAGATGTACGGTGGTGACAAATCCATCATGTACGAAAAGATCGGCCTTGTA
GAAGAGAGTGACATAGATAAGTATCGCAAAAAGCTAGGAATCAAGAAGAACGTCACTGAT
TTGGTATCAAAAGACGCGGAAGACGTAGAGGATTTAGTCAGTGAAGCAGCTGCTGTGTAG
ATGCAAGGTATAAATAGTAAAACTAAGCACAAGGGCAGACAGGTTAAACTCAAGCAATTC
GAGTAGGACGAGTTCAAGAAAATACTGCATAATTATTAGGAAGAGCAGAAGAAGAGAGAG
GCAATGAGTCCTGTAGAGCAAGCCAGATATGATCAAGAGAGATAAAAACTCAAGGAAGTT
TACAGAGATGAGGATGTTAAGCATTTCCCAATAATGATAAAAGCATCATAAGCAGGAGTC
CTGGAGACTCTCCTGAAAGAAGCAGAGAAAGTGGTGGGCACTCACAACTACAGAATAAAC
ATAATTGACTATTCAGTGGGTCCAGTGACTGAGGGAGACATGAACACTGCCTTGCAAACT
GGTGCTGTTATATTTGGATTTGATGTACCTATTGCACCTGTGGTAAGCAGAACTGCTGAA
TCAATTGGAGTATGTGTCAAGCAACATCGTATCATCTACAAGTTCTTGGAGGATGTGGAG
CACTTCGTTTATGATGCTAATACCAAAATTCAGGAGGAGTCAGGTAAAGCTTTTCATGTA
GAAGTTGTTGGTACTGCAGCAATTTCACAATTATTCAAAATAAAAGATCCCAAAGCCAAG
GGTAATAAATTGCTAACAGTGGCTGGTTGTAAAGTTCACGGTGGAGACATTGAGAGAAAA
TATAAATTCAGAGTGGTAAGAAACGGTAAAATTCTGCAAGACAATATCAAACTGCACAGT
ATGAAGAAAATGCAATAGGATGTCACAATAGTAGAGAAAGGGCATGAGTGTGGTTTATGT
CTCGATAATTTTGATGGGGAATTACTACCAGGAGATGAAATAGAGGCATACAAGGAATTG
GAAGGCAAATTGATTAAGTTTAACTCAAAGCCAGGCATTCATCAATCCTATTGA


>Contig17818.0.g40(protein)
MDSHEILKRIEIISNDTIIDEFTDLPVELIETLAVEYEKEVEIIKDDKARAQFKERPPVI
TIMGHVDHGKTTLLDAFRHSQKVKEEYGDITQAIGAFTFVTDSEHEITFIDTPGHEAFQN
LRLRGAKTTDMIILVISAIESIQPQTIEVIQISQKLKIPVIVAINKIDRNSADPDAVMLD
LATYDMIAEELGGDLVCVPISAKQKTNLDLLEQKIVEVAHSRVDLMEDFGCRAQCYIIES
NFDEKSTQVTATVLVKKGTLNQDDIFVCGPHEGKVRFMRNDQGKNVKSAYPGQAVHLAGF
KSFPEVGLPLYACKNHEEAQFMANRIQTRRDKEEQMKLFDDQLASEGLDMKKKIKGLTRM
EKRKMYGGDKSIMYEKIGLVEESDIDKYRKKLGIKKNVTDLVSKDAEDVEDLVSEAAAVQ
MQGINSKTKHKGRQVKLKQFEQDEFKKILHNYQEEQKKREAMSPVEQARYDQERQKLKEV
YRDEDVKHFPIMIKASQAGVLETLLKEAEKVVGTHNYRINIIDYSVGPVTEGDMNTALQT
GAVIFGFDVPIAPVVSRTAESIGVCVKQHRIIYKFLEDVEHFVYDANTKIQEESGKAFHV
EVVGTAAISQLFKIKDPKAKGNKLLTVAGCKVHGGDIERKYKFRVVRNGKILQDNIKLHS
MKKMQQDVTIVEKGHECGLCLDNFDGELLPGDEIEAYKELEGKLIKFNSKPGIHQSY