Identifiers and Description

Gene Model Identifier

Contig12183.0.g23

Standard Name

MTFMT

Aliases

Contig12183_0_g23

Description

Formyl transferase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

  • hydroxymethyl-, formyl- and related transferase activity (IEA) | GO:0016742

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010357104.0013320766793207e-25Formyl transferase family prot
ein
SGDYBL013W0.00000000030007160092483236FMT1 SGDID:S000000109, Chr II
from 202056-203261, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12183.0.g23(coding)
ATGTTCGTGATTCATCCATCACTTTTACCAAAATATAGGGGGTCTTGTCCCATTCAACAT
GCTATTTTAAATAGAGACAAATAGACTGGAGTTAGCATCATTGAAATTTCAAAGAACAAA
TTTGATGCAGGAAAGATACTATGGTAAGAAAAGGTAGAAATTAATGAGAAAACTGATTTC
GAATCATTGTCTAAACAATTAGCTGACCTTGGAGGATAAGGAATGTGTGAATTATTGAAA
GATTTACCAGGATTTAAAGAAAGAGGGCTTAATTAGGATCCTTCACAAGTTACATCTGCA
AGAATGATTAAAAATGAGTTTGGAATACTCAAATTCTCTGAATTAGATGCTCTTGATATT
CATTATCGATTCAATGCCTTAAATGGTTCAAATACTAAGCCAAGAGGAATAATTCACTCT
GGCTTTGATAAGAAGCTGATTGGAACAACTATATACTTTGATAAATTACACAAAATCGAT
CCTCCCCAAGAAATTAAGACCCTAAACTTGAATATTCCAGAAGGAGCCTTGTATGTGAAT
CACAAAAAGAATAAAGATGTATTATATATCAAGGCAAAGGGTGATGACTAATGGGTGCAT
GCAACATAAGTCACACTTTCAGGTTTTGGGAAGATGCCAGTCAATGATTTTAATGTAAAG
GTGCTCAAGCATCAGACTTTTAAACAAAATGATGATCCCTAATTTAAATTTAGACTAGAA
TGA


>Contig12183.0.g23(protein)
MFVIHPSLLPKYRGSCPIQHAILNRDKQTGVSIIEISKNKFDAGKILWQEKVEINEKTDF
ESLSKQLADLGGQGMCELLKDLPGFKERGLNQDPSQVTSARMIKNEFGILKFSELDALDI
HYRFNALNGSNTKPRGIIHSGFDKKLIGTTIYFDKLHKIDPPQEIKTLNLNIPEGALYVN
HKKNKDVLYIKAKGDDQWVHATQVTLSGFGKMPVNDFNVKVLKHQTFKQNDDPQFKFRLE