Identifiers and Description

Gene Model Identifier

Contig6535.0.g98

Standard Name

MTD1

Aliases

Contig6535_0_g98

Description

Methyltransferase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005787209.997441244797434e-45hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6535.0.g98(coding)
ATGCCAAATAGTTAGATTATTAATACTGGGATAAATCCAAATGGATAATAAAATTAGAAG
CAGTAACCTTTAGCAAATACTTAATTTAAAAAGTTAGTACAACCTCTTACAGGGCAAATA
GTCCTGCCAACAGAATATCCCGACTACTCAAAGCCAGATTATTGGAACAATAGATATCTT
GATGAGCGGGGATAAGTGTTCGACTGGTATTTGAACTTCGCTTAACTCAAAGACATAATC
ATGCCTAGATTATTTGATGATAAGGATGCTGAAATACTCAATATTGGCTGTGGTAACTCT
GAAATGAGTGAGAAAATATATCAAGAGGGATATCATTATATCACAAATGCAGATTTCAGC
ACAATAGTCATTGAAGAAATGAAGGAAAGACACTCGCATTTAGACGACATGGATTACGTT
GAGATGGATATAACTGAACCCATGGACCTGTTGGATTCTGATTCTTTTACAGTAATATTA
GATAAAGGAACTTTGGATTGTGTTGCATGCTCAGATTAATACTCCAAAAACTCAAAGTAA
ATGATTGAGAATATACACAGAATATTGGCCCCTGGAGGCAGCTATATTTGTGTGAGCTAT
GCCAGACCTGAGACGAGATTTGTCTATTTAAAGGAATCCTCTCTTAAGTGGAAGGTTGAA
GTTGTAAGGATATAGAAGAAATCAAGTATTGAATTAATGGAAAGAATTGATTAGGAATAG
TACTATTATGTTTATATATGCACTAAGAATTATTGA


>Contig6535.0.g98(protein)
MPNSQIINTGINPNGQQNQKQQPLANTQFKKLVQPLTGQIVLPTEYPDYSKPDYWNNRYL
DERGQVFDWYLNFAQLKDIIMPRLFDDKDAEILNIGCGNSEMSEKIYQEGYHYITNADFS
TIVIEEMKERHSHLDDMDYVEMDITEPMDLLDSDSFTVILDKGTLDCVACSDQYSKNSKQ
MIENIHRILAPGGSYICVSYARPETRFVYLKESSLKWKVEVVRIQKKSSIELMERIDQEQ
YYYVYICTKNY