Identifiers and Description

Gene Model Identifier

Contig17419.0.g36

Standard Name

MT1b

Aliases

Contig17419_0_g36

Description

MT-A70

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

  • nucleobase-containing compound metabolic process (IEA) | GO:0006139

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010051502.0009605191578312e-25hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17419.0.g36(coding)
ATGAGTGAAAAGAAACCAGCAAGAAAGCAAAAGAAGTCAGAGACTTCCCCACAAGCACAG
CCTCCAGCTAACTCAGGAGGAAATTTGGAGGCTAATAGTGGAGACAACTCCAATCAACTC
AAAAAGCAGAAACAGAATTTGGCTTTGAGCAACAATGGAAACTCACTAGATAAAATTTGC
TCACACCTGAAACCTCAAGCAGCAGGTTTGAAAACATCTGGTTAGGGTGTCTCTTAGCAA
CAACAGCATCAATCTATCTCTTCAAGCACTGGAGCTGCATCCGTGAAAACTCTTACCTAG
TCATCGGGAGAGGAGTCACTCTCTCAAAGCCAGCTTGGCAAGAGAAAGGAAAGAGGAGAG
TTTCTTGGGAATACTAACTCAAACAACAGCTAAAATCAGCAGCAGACTAGACCTAACTTG
AGAAGATAAGCTAATGCAAACGCTATTCCAGAGAGCAATGAGCAGAGGAGAGATTCATCA
GTGAGGGAAAGTGAGCAGCCACAGTTCTACTCAGACTAAACTCAATTGGAGGGTCAAACT
CAAATAACTTCTTTCTTTGGTGGTGGTCCTGGAGCAACCTAAAGTACTTAAGGAGGACAG
ATGATGGGAGGAGTGAATCCTGGTTCCCCTTAACAGCAACTCATTCAGTCAAACAAGAAG
CAGTACATGTTCAAAGCCAAGAGACATCCAAAGTCGTTGATGAAAGAAGGAGTCTCAACT
TTGAGATATGTGGAGGGCAAGGAGACAATCTTCTAGATCATCATGCCTTGGAGACAAGAG
AAGGAGGATGAGGAGAAGAAGAAAGTCAAGAAGCAGAAGAACGAAAATGAACTCAAGCAA
TCTTCTCTCTCTAACTGGATGAAGAAACCACCTGCTCCCAAGAAGAATCCTAAGGATGAT
GACTAGAACAAAGTGATATCAAAGGAAGAGTTGAAGTACCAAGAGCACAAATTTGGTAAT
GAGGAAGACGATGAGGACATGTCCAGAGTGAGCAAGGTCATAAAAGTGAAGGAAGTGTAG
AGCATCAGACTTACAGACTACACAGACAAGGATGCTCATGTGCAAGCCATACTCATCAAT
CCTAAGTGGAAAATCAGCCAAGATATCTATGGAGATGGAGATACTGAAGAAGGATCTATG
CAAGAAGGAGGTGACTCAAGCAGTGAAGAAGATGTGAAGCAAGGGAAAGGCATGCAGATG
AAGTCAGCCAAGAAGCAAAGAGCAAATGCTTTTCAAGGTATCACAATGAAAGAGTTCTCG
AAGTTGGTATTTCCCTAATCTCTTGTTTATGACGGTATTTTGTTCATATGGGTGGAGAAG
GAGTACATCATGGACGTTTGCAAGTTCCTTGAAGACTAGAACTTTTTCTACATTGAAAAC
ATGTGTTGGATCATGCTTGATGAAAACATGAGAGAAGAGGTTGAGAAGACTAGACTGCAA
GATGCTACACCTGCTTTTGTGAGAGAAAACTACACTTATTTCAAAAAATCGAAGAAAACT
CTGTTGATGTTCAGAAGACTCAGTACTGATGTGAACAATAAGCTTGAACTCAGACATCAG
AGAACTGGAGATGTAGTCTTTGACTGGAAAGATACTATCAACCCACACTCTAAGCCACAG
TACTACACTTACAAGTTGATAGAAACTCTCCTTCCCAAAGCTATGGTTGACCTGAAAAAA
CAACCTCACCTCAGAATGATTGAATTGTGGGCAGAAGATGATACACCCAGAAAGGGTTGG
ATTAAGTTCATCGGCCTCAATCAATGA


>Contig17419.0.g36(protein)
MSEKKPARKQKKSETSPQAQPPANSGGNLEANSGDNSNQLKKQKQNLALSNNGNSLDKIC
SHLKPQAAGLKTSGQGVSQQQQHQSISSSTGAASVKTLTQSSGEESLSQSQLGKRKERGE
FLGNTNSNNSQNQQQTRPNLRRQANANAIPESNEQRRDSSVRESEQPQFYSDQTQLEGQT
QITSFFGGGPGATQSTQGGQMMGGVNPGSPQQQLIQSNKKQYMFKAKRHPKSLMKEGVST
LRYVEGKETIFQIIMPWRQEKEDEEKKKVKKQKNENELKQSSLSNWMKKPPAPKKNPKDD
DQNKVISKEELKYQEHKFGNEEDDEDMSRVSKVIKVKEVQSIRLTDYTDKDAHVQAILIN
PKWKISQDIYGDGDTEEGSMQEGGDSSSEEDVKQGKGMQMKSAKKQRANAFQGITMKEFS
KLVFPQSLVYDGILFIWVEKEYIMDVCKFLEDQNFFYIENMCWIMLDENMREEVEKTRLQ
DATPAFVRENYTYFKKSKKTLLMFRRLSTDVNNKLELRHQRTGDVVFDWKDTINPHSKPQ
YYTYKLIETLLPKAMVDLKKQPHLRMIELWAEDDTPRKGWIKFIGLNQ