Identifiers and Description

Gene Model Identifier

Contig1237.1.g126

Standard Name

MT1a

Aliases

Contig1237_1_g126

Description

MT-A70

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

  • nucleobase-containing compound metabolic process (IEA) | GO:0006139

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010051501.9996410647472548e-29hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1237.1.g126(coding)
ATGCTGAAGAGTCAAGAGGGAAAGAAACCCAATTAATAATAAACTAATGGCAGGGTTACC
CGTAACAAAGCTCCATAAGACTACAAGAAGATGTTTCACCCTGATGTATTCTCAGACGAT
GACGACTTTGTGCCAAAAAACAAGGGGAAAGCAAAAAAGAGGGATCTCAAGCGTAAACTC
AAGGTTAAGAAGGGTGGTAGGTTTAATAACTACGAAAATATTGGCGCCTAAACCAAGGGA
TAAAAAACAGGAGAGAGAAAGGTACTCGATGGTGTGAGCATCTTCGACTTGATCATACCC
TGGAAAGAGAAAATAAGCGGATAACCTAATCAAATTGGAAGCATGAAGAAATAACCATCG
AATGCTTCATCAACAACGCAAACCTCTTTGTCATCTTTCCTCTCGAAAAATAAAGGCGAA
GCCGCAAATAAAGCAGACTAAGTGAATGGTATTAATGGTGCCAATTCCAAGGCAAAGAGT
TAAGTTAATGACTTAGTAGCTTAAGGTCTTGCTTAAATTGTTTAATCTAAAGAACCAATC
GTTAAAACCAATTTTGACAAATATGCGAAAAATGTAGAGGCCATTCTTATTAACCCTTGC
TGGTAAACCTAGAAAGACAAGAACGGAAAAGTAAAGGGAGTGACTATGGAGGAATTCTAG
AAGCTTAACTTCTCTAAGGATCTTATGATTGATGGTCTGGTCTTTGTGTGGGTCGAAAAG
GACATCATTTATCCAGTAATTAAATTCTTTGAAACTTAAAGCCTGTTCTATGTGGAGAAT
GTATGCTGGGTCATGCTTGATCAAACAAAGAAATAAGAGGTTGAGGCCACTTAGAGCATA
GAAGTATCTCCCGCTTACGTAAGAGATGATTACCAATATGTTAGAAAATCACACAAAACA
CTCTTGATGTTCAGAAGAATGCATAAGAAAAACGGAAATCCACTCGAACTTAGGCACTAG
AGAACTTGCGACGTCTGCTTCGACTTCGTAGAAACTGATGTTCATAATTATAAGCCAAAC
GAATACATCTATAAATTGATCGAGACTCTTCTTCCTTAGGCATCAATTGATGAAGAGAAA
AAGCATGTCAGATTAGTTGAATTATGGGCTCACGACTCCACTCCCAGAAAAGGTTGGATT
AAATTCATAGAATGA


>Contig1237.1.g126(protein)
MLKSQEGKKPNQQQTNGRVTRNKAPQDYKKMFHPDVFSDDDDFVPKNKGKAKKRDLKRKL
KVKKGGRFNNYENIGAQTKGQKTGERKVLDGVSIFDLIIPWKEKISGQPNQIGSMKKQPS
NASSTTQTSLSSFLSKNKGEAANKADQVNGINGANSKAKSQVNDLVAQGLAQIVQSKEPI
VKTNFDKYAKNVEAILINPCWQTQKDKNGKVKGVTMEEFQKLNFSKDLMIDGLVFVWVEK
DIIYPVIKFFETQSLFYVENVCWVMLDQTKKQEVEATQSIEVSPAYVRDDYQYVRKSHKT
LLMFRRMHKKNGNPLELRHQRTCDVCFDFVETDVHNYKPNEYIYKLIETLLPQASIDEEK
KHVRLVELWAHDSTPRKGWIKFIE