Identifiers and Description

Gene Model Identifier

Contig820.1.g122

Standard Name

MSH6b

Aliases

Contig820_1_g122

Description

MutS domain V

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001948109.997093137033517e-262MutS domain III family protein
SGDYDR097C8.002579675247075e-150MSH6 SGDID:S000002504, Chr IV
from 643837-640109, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig820.1.g122(coding)
ATGCAAAAAGCTTTGACATCATTTTTCTCTAAGAGACCCTCAGCTGTGGGAACGACTCCA
AGTACTAATGATCTTGAAGATTCTAATGCCAAAGGAGCAATGGGATAGCCTCGTGAATTC
AATTAGAAGAAATCTAGAACAATCAGCGAGATAACTCCATGCAAGAAGGAAGAAAAGAAG
GGAGGTAACTCAAATTCAAAGACTAGTTCAAATACTGAGACTTAAAATAAAATTGCACAC
CCTCCTCGCTTTGGTGAAAAAGTCAACTAACCCAAACTCAGTAATTTGGAGAACGATGAG
GAAGAAACACCTTTGAGAAGGAAATAGACTTAGAGAAGGACATACAAGGATGAATCAGAT
GAGGAATATGAAGTGGCCTCAAAGCTAAATGACAGCGATGATATTGACATTGATGATCTA
GACTTAGATGAATCAGAATCAGAAGTCTCTCATGAAGCAAAGGGAAACAAGAGAAAATCA
GCACCTGGAGGCAACGGCAAGCGTAAACCTGTGCAAAAAATACTGGAAAACAAAAAATTG
AATTCTACACCAGCTCCTCCAAAGAAATAATTAACATCTAGTGCTACTGGCCAGAATTCC
ACTGCAGCTTCTGCAACAGACAAGAAAGTTATGAGATAAAGTGACATTTCAAACTCTTCC
AGAACATTGAATGATGAGCCCTCCTATATCGACTAGGAAGATCAAGTTATCGGTGGTGGT
TTCCAAACTCATGATGACATCTTAGAAGCAAGGCCAGACTTCATCAAAGAAGAGTACATA
ATGGACATGGAAAAGCGCAAACCAGAGGATCCAGAATACGATCCTACTACATTGTACATT
CCAGGAGATAAGTGGAATGGCTTCACACCAGCTATGTACTAATACTGGGAGATCAAGGTT
CACAACTACGATAAGATACTCTTCTTCAAACTGGGTAAATTCTATGAGATCTTCTACAAT
GATGCAATTATCTGTCAAAAACTACTGGATCTAAATTGGATGGGAGGTGCTAAAAAGTTG
CATATTGGTTTCCCTGAAAAGGTTTTAGACAAATACCTTGTGATAATGGTAAATCATGGA
TATAAGGTGGCAGTCATAGAGCAAACTGAGACACCTTAAATGATGGAGAGAAGATTAAAA
GAAGAGAGATTGGCAAAGAAGAAAATGGAGCCTAAGGATAAATGCGTCAAGAGAGAAATT
TTCAGTATGGTTACTAAGGGCACCTTTAAGGATAACAACCAATCAGTAGCTGGGTATGAA
CCTAAATTCGTACTAAGTGTGAAGAGATACGGCAGTGAATTGGGTGTGACATTTTTTGAT
GTACAAACACTTAAAATCTACGTTGGCTAATTCACAGATGATGAGGCTCTTTCAAACTTC
AGAACTCTACTATGCTAGATTAGACCTATTGAAGTTATCCACGAAAGAGAGATCATTAAC
TCTGACATGTTAAAAATGTTAAAGAACTCTCCAGTAGTCCCAGTATTCACCCCCATGGTA
CCTAAGAACTGCTGGGGTGTCATAAAAACTTGCAATGCTTTAGAGACATACATCGGACCC
TCCAAGAACTGGCCAGAGCTACTGCAAAAGTTCAAGGAATAAGATGCAGAACTAGCTTTG
TAAAGTCTGGGTATGGCTATTGCCTTTTTGGAGGAAGCACTCATTGCATAGTAAACAATT
TCAACTGGTGAGTTCCATTTATACACCCCAGAGACTCAATCTCAACTCGAGTATATGGTG
TTAGATTCTCAAGCTCTGTAGCACTTAGAAGTGGTTGAATCTGCATCTGGTAAATTTGAA
GGCTCCCTCCTGCACTATATAGATCACTGCAAGAGTCCCTTCGGAAGGAGACAACTCAAG
AGATGGGTACTCAGTCCACTCATGAACATTTAGAGAATTGAGGAGAGATTGGATGCTATT
GAGGATTTGATCTAACATCAATATGAAACTGATGTCTTTAGATCCAAGTTATCAAAACTA
CCAGATATAGAGAAACTACTTGCTAAAATATACACTTACTCAATCAAAAACAGAGTAAAG
GCTATCTACTTCGAGAATGTATCACTCATTAAACTCAAGGAATTCCGCATACTTTTGAAA
CATTTCAGAGTTATGGAGGAATTATGTGAGTCATTAATGAATAAGAAAAATGAATTCAAG
TCCCAAAGACTCAGATAACTTCTAACTCCTGACACAGAATAATATGGACTTTTTCCAACT
GGCATCAAGGATATTGTTAAGGAATTTGAAGGCATGATAGTCTGGAAGAAAACTCAAGGA
GGCGGTCCTGATGATGAAATACCTGAACCATAGATGGGCTTAGATGAGGAATTTGATAGG
GCTAACGAAGCAGTTGACAAAGTGAAATAGAAACTAGAGAGCTATCTGTAATAAATCAGA
TCGCAATTCAAAGACCGCAGAATCAATTGGTCACATGCCAAGTACAGATATGAACTCGAA
CTACCAGCTGAGTTAATCGATGGAAAGAAGAAGCCTGCGGATTTTGAATTCACTTCACAA
AGAAACGGTTATCAAAGATTCCATACCAAAGAGATCAAGCAATACGTTGAGGAGCTAGAA
GTTGTGGAGGAAAAACTCAAGGATGATTTAACCCCATTCTTGTGTGCTCTTTTCCAGAAA
TTTCATGAACATAAGGATCTTTGGAATAGAACAATGAATGTGATCACTGAGTTGGATTGC
CTCTGCAGTTTGAGTATCGTGAGTGGGTAAAGTGTTGGAGATATGTGCAGACCGCAATTC
GTTGGCTATCAAGGTGAGTATGCCAATTCAAGTTTGTTGGATATCAAGCAATTGAGACAT
CCTTGTGTGACTTTGAATCAGACAAAATCTTTTGTTCCAAACAATACCCTGCTTGCTCCT
AATCAAGACCAAACTTTGCTGCTAGTTACTGGGCCAAACATGGGTGGTAAATCAACTCTC
CTCAGACAAACTTGCATTGCAGTAATATTAGCTTAAATAGGGTGCTATGTCCCAGCTCAA
TCAATAAAGCTTAATCCAGTAGATCGTATCTTCACTCGTATCGGTGCTAGTGATCGCATC
TTAGAAGGCAAGTCAACTTTCTACGTCGAAATGGAAGAGACCAAGAACATCATTTAGTTT
GCCACTTTCAAATCTCTAGCTATTGTGGATGAGCTGGGTCGTGGTACCTCTACCTTTGAT
GGTTACTCGATAGCTCATGCTGTCTTGAAGTATCTTGTAAACAACATTAGATGCAGATCG
CTGTTTGCTACTCACTATCACATGCTACTCGATGAATTCAGAGGTGCTAGAGGTGTGAAG
AGCTATCACATGGCTTGCAGAGCAAATGAAGATAAAGACGAAGTCATGTTCCTTTATAGA
TTTGAGAAGGGTGAATGCCCTACTAGTTTTGGTATAAACGTGGCTAGAATGGCTGGTATA
CCAAAGAATGTGTTAGATGCTGCTAAACGTAAGAGTCTTGAATTCTCTGAAAAGCTTAAT
ATCCTAACTGATAAAGTGAAAGAACATAAACACCTCAGATCAAACAACATGAACGAATAA
GAGAACAGTCAAAGTTGA


>Contig820.1.g122(protein)
MQKALTSFFSKRPSAVGTTPSTNDLEDSNAKGAMGQPREFNQKKSRTISEITPCKKEEKK
GGNSNSKTSSNTETQNKIAHPPRFGEKVNQPKLSNLENDEEETPLRRKQTQRRTYKDESD
EEYEVASKLNDSDDIDIDDLDLDESESEVSHEAKGNKRKSAPGGNGKRKPVQKILENKKL
NSTPAPPKKQLTSSATGQNSTAASATDKKVMRQSDISNSSRTLNDEPSYIDQEDQVIGGG
FQTHDDILEARPDFIKEEYIMDMEKRKPEDPEYDPTTLYIPGDKWNGFTPAMYQYWEIKV
HNYDKILFFKLGKFYEIFYNDAIICQKLLDLNWMGGAKKLHIGFPEKVLDKYLVIMVNHG
YKVAVIEQTETPQMMERRLKEERLAKKKMEPKDKCVKREIFSMVTKGTFKDNNQSVAGYE
PKFVLSVKRYGSELGVTFFDVQTLKIYVGQFTDDEALSNFRTLLCQIRPIEVIHEREIIN
SDMLKMLKNSPVVPVFTPMVPKNCWGVIKTCNALETYIGPSKNWPELLQKFKEQDAELAL
QSLGMAIAFLEEALIAQQTISTGEFHLYTPETQSQLEYMVLDSQALQHLEVVESASGKFE
GSLLHYIDHCKSPFGRRQLKRWVLSPLMNIQRIEERLDAIEDLIQHQYETDVFRSKLSKL
PDIEKLLAKIYTYSIKNRVKAIYFENVSLIKLKEFRILLKHFRVMEELCESLMNKKNEFK
SQRLRQLLTPDTEQYGLFPTGIKDIVKEFEGMIVWKKTQGGGPDDEIPEPQMGLDEEFDR
ANEAVDKVKQKLESYLQQIRSQFKDRRINWSHAKYRYELELPAELIDGKKKPADFEFTSQ
RNGYQRFHTKEIKQYVEELEVVEEKLKDDLTPFLCALFQKFHEHKDLWNRTMNVITELDC
LCSLSIVSGQSVGDMCRPQFVGYQGEYANSSLLDIKQLRHPCVTLNQTKSFVPNNTLLAP
NQDQTLLLVTGPNMGGKSTLLRQTCIAVILAQIGCYVPAQSIKLNPVDRIFTRIGASDRI
LEGKSTFYVEMEETKNIIQFATFKSLAIVDELGRGTSTFDGYSIAHAVLKYLVNNIRCRS
LFATHYHMLLDEFRGARGVKSYHMACRANEDKDEVMFLYRFEKGECPTSFGINVARMAGI
PKNVLDAAKRKSLEFSEKLNILTDKVKEHKHLRSNNMNEQENSQS