Identifiers and Description

Gene Model Identifier

Contig18281.0.g80

Standard Name

MSH5

Aliases

Contig18281_0_g80

Description

MutS domain V

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDL154W9.995528898049344e-31MSH5 SGDID:S000002313, Chr IV
from 178334-181039, Genom...
T. thermophilaTTHERM_007630401.999598840915195e-17MutS domain V family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18281.0.g80(coding)
ATGTAAAAACCATCATTTAAAACTAACCCTACACAACAAAGAAATAAACAAAAACTTTAG
TATGAATCTAAACTCTAAGTTTGCTTGCACTATGAATACTTATCAAATAAAGTCTTGATT
GGTCTCTTAGATCGTGAACAAGCCAATCAATAAAACTCAAGAGATAAATACCAAAAGGTT
CATTTGATTATATGTAAAGAGCTTCAAGTTGCTGAGATTTTGACTGATTTTTTGCAAGAA
CTATATGAAACAGATAGTAGAAAGATCCAACTAACCTTCTATTTTGCTTAAAAACTACAG
AAGAAAGTAAGAGTAATCTAAAAACGTCTCGAGAAAGACAACTCAATCAAAACATTTTTG
ATAAACACATCATTCGAAGAGTAAGATTTGATTGAACTAATTCATATTGATGAAAAAGAT
ACACTTTACAGAAACTCATGCAAAAAAGTATCTGAAAACTCTAAGTTGATTTAAGATTTA
CAGATGTAAGAGCATTTTAGATATGAGCTGCAGTATTGTATGCTTGAACTTATAGGGGTT
ATGATGACTGTTAACATTATACACTGGAAAAATATCAAAGAAGATCGAGTGAAGTTTGAT
ATTTTTAATAGAAACTTTGTGGGATTAAATCCTGAATTAAATGATTCAATAACTATCCAA
GAACAGTAATTGCATTAAGAAAAAGCTAGTAATTTAACTTTCTTAAGTCCAGACTAAGAA
ATGAAACTATAACTCTCTATTACCAATTAATCTCAAGCTTAAGATAAATTAGAATTGGTT
GAAGTTTGTGAGAGTTTCTACTAAGACTTGAATATCTTCCAAGATTAGATACATCCATCC
TTGCTAATTCAAAATGCAGCTCCTAAAGAAGGTTATTCCCTTTTTAATTTGTTTGAGTTT
ACTATATTATCAAAAGGTAGAGAATATCTGAAGCAAATATTTTAAACTCCACTTAAATGC
CTAAATTAGATTATGTATAGGCAAAATTCTGTCACTGCTCTTTTCGATTTGAATAGCTAA
TGTGGATCTATGTTTAATAATAGGCCTTTATATCTGGAAGTTTAAGCCAAACTAAAGGCT
TTTCATGACATTGAATCTATAATTGGCTCATGGAAAAGAGAAAGAATCTTTGATGTTAAA
AGCATCAAGAACCTTCTCAGAAGCATTCAAATATTTTGTTAGATAGATGATATGCTTTAT
GATCATTTCATTACTCTCAATCAAAAGTCAGAGCTAAAAGATTCTTTGCTCAAGATTGAC
AAAGATATTCTGGCAAGCGTATACACTACAATCTTGCAAGGATTAGATTTGAGTGGCACT
AAATTATCAATAAGGAAAGGTATATTTGAGGAGCTTGATACTATAAGAGATCAATATAAC
TCTTTAGATGATTAAATGTCCTTCAAGCTTTAAGAACTAAAGTATGACTTATAGGAACTA
CCAGATTTTATGCAAAGGGTAAGAATGATAATGATCCCATCAGCCGGTTACTTTGTGTCT
ATAAGTAAATGTGATTAAGTTTACGTGAGATATTTAGAGCAAAACATGAAATAATTTAGG
TCAATGGTAAATGTCATTGATGAGCATGATTTGATAAATTTTATGCTAGAAGATGATTTG
AATAGATTAGGCTGGAGATTCAGTTTTGTGACTGAAACTGATTTATACTTTTAAAACTAG
GCTACGAGAGAACTTGATCAAACCCAAGGAGATTTATTCAGTCAAATTTAAGAAATGGAG
TTTTATTTCTTGTCTGTAATTTAGAAAGAAATTTTAGATAATGCCTCGGTATTGCTAAAG
ATGAATGAATTTATTATAAAACTTGATGCTTATATCAGCCTTCTAATGTCAGTCTTGGAG
TTTAATCTTACAAAGCCAAACTTTGTTACAGATTCAAAGTAAATAAAGATTTAAGATGCA
AGAAATATGTTGGTTGAATTCAAGAGTCAAGATTTTAGAAAGTAAGATTATAATATAACT
GACTAAAAGTTAACTGTTATTTGTGGTTAAAATGGGTCAGGTAAGAGTATTTATCTGAAA
AATTTGGGCTCAATCATATATCTAGCTTAAATAGGTTGCTATGTCCCCTGTGACTCAGCT
ACTCTACCAATCTTTACAAAAATTTTGACAAAGTTTGCTTCTAATGAAAACTATACAAAC
TTCCAAAATTCATTCTTCTACCAAGAAACAACTAAAATGACGCATATTCTCAACTCTTGT
GACTAAAATTCTCTCCTTTTGATAGATGAATATGCCAGAGGGACTTCGCATATCAATGGT
ATGAGTCTATTGATTACCCTAATTGAATGTTTGAGCAATCTGAATTTCTTTAAGCAAATT
AAGAATGCTGACAAATTTGTAAAAAACCTACCTATTACTCTGATATCAACGAATCTTGTT
GAGATATTTGAATAAGAATAAATATGTAAAATTAAACAAACATCAAATCTCAAGATTATT
CAAATTGATAACTAAAATACTCAGGATTAAGCTTGTGACAGATAGCTATTATCTTTGTAT
TAAAACACTTTGAGACCTATTGAATGTGCTAAAGAGACAAACTTAGATGGGAAAATTATT
AAGAGAGCTTAATTTTTGGAGAAATGCTTTAATGAGAAGAGGAAAATACTCTCAGATCTT
GAAACTTGA


>Contig18281.0.g80(protein)
MQKPSFKTNPTQQRNKQKLQYESKLQVCLHYEYLSNKVLIGLLDREQANQQNSRDKYQKV
HLIICKELQVAEILTDFLQELYETDSRKIQLTFYFAQKLQKKVRVIQKRLEKDNSIKTFL
INTSFEEQDLIELIHIDEKDTLYRNSCKKVSENSKLIQDLQMQEHFRYELQYCMLELIGV
MMTVNIIHWKNIKEDRVKFDIFNRNFVGLNPELNDSITIQEQQLHQEKASNLTFLSPDQE
MKLQLSITNQSQAQDKLELVEVCESFYQDLNIFQDQIHPSLLIQNAAPKEGYSLFNLFEF
TILSKGREYLKQIFQTPLKCLNQIMYRQNSVTALFDLNSQCGSMFNNRPLYLEVQAKLKA
FHDIESIIGSWKRERIFDVKSIKNLLRSIQIFCQIDDMLYDHFITLNQKSELKDSLLKID
KDILASVYTTILQGLDLSGTKLSIRKGIFEELDTIRDQYNSLDDQMSFKLQELKYDLQEL
PDFMQRVRMIMIPSAGYFVSISKCDQVYVRYLEQNMKQFRSMVNVIDEHDLINFMLEDDL
NRLGWRFSFVTETDLYFQNQATRELDQTQGDLFSQIQEMEFYFLSVIQKEILDNASVLLK
MNEFIIKLDAYISLLMSVLEFNLTKPNFVTDSKQIKIQDARNMLVEFKSQDFRKQDYNIT
DQKLTVICGQNGSGKSIYLKNLGSIIYLAQIGCYVPCDSATLPIFTKILTKFASNENYTN
FQNSFFYQETTKMTHILNSCDQNSLLLIDEYARGTSHINGMSLLITLIECLSNLNFFKQI
KNADKFVKNLPITLISTNLVEIFEQEQICKIKQTSNLKIIQIDNQNTQDQACDRQLLSLY
QNTLRPIECAKETNLDGKIIKRAQFLEKCFNEKRKILSDLET