Identifiers and Description

Gene Model Identifier

Contig848.0.g75

Standard Name

MSH4

Aliases

Contig848_0_g75

Description

MutS domain V

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOL090W7.996806159126539e-24MSH2 SGDID:S000005450, Chr XV
from 147382-150276, Genom...
T. thermophilaTTHERM_002959202.000620012690291e-23MutS domain III family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig848.0.g75(coding)
ATGAGGAGATTATCAGAAAACCCAATATATCAAAGATATGATACTTAATTCTTGCAAAGT
CAGAATAATCAAATAACAGCTAAAATCAGTCCTTAAAAAAATCAAATTATTAACTTACTC
GAACCTCAACAAGATGGGGATCTTGATTTTGAATAGTCCAATATTAATAGAAACTCCAAT
AACTTAAATGAACTTTAGTTTGATGGTGAAATTGAATGCTAAGGATACACATCAATCGCA
GCTATTAGCGAAAACAGAGGAAGAGAAGTTGGAATTGCGCTTTATACTCCATTTAAGAAT
AGAATAACTCTCTGCTAATTGGTAGATTCTGCACTTTACAATTAAACTGTCATGATACTT
AACAAGTTTGAAGTAAAAGAGTTAGTTATGAGCTTGAAGCCAGAAAAATTTCATATCTTA
AGTAACTTAGCTTTAAAATATGAAAAACTTATATTTATAGATAGGAGTGACTTTAACGAG
TAGTCCGGCTATGATTTACTGAAAGAATTCGTAAGTGATTCAAAGTTACTTGAAAGCTGT
CCATCAAATTATGTGTCTATCACATGTTTAAGTGCACTTTTGTTGCACTTAGAAGCCAAT
CATAAGATCTAGCTTGATTCATCAATTACCAATTTGACTTTCTTTCAAAGTTCTAACAGC
TTGTACATTGACCAAAGCACATGCTAGAAACTATCTCTGATTTCTTTATCGGGAGATTCC
AAGAAAGATTCAGGCATTACTTTACAGTCACTTTTCAAAACCATTAATCCCCTTGGTCAA
AAACTTTTGAGACGCATGATAGTTTCACCCTCAGCAAATCCATCTAAACTTAACTACTAT
TATGAAATTTTGGAAACTCTTCTCAATTCACACTCCAAAACTAATCTATGTATATTACTG
CAAAATTACATAAAATAAATGAATCAGATTGAGAGTTCTCATACTTAAATAGTTTATGTG
ATGCGAAGATACACAGTTAAGAGACCAATTACTTTTTTAAGCAACTTGATTCGATTTATA
CATAAACTTAAGTAGTTCTTTGCCCTAATGAGTTTAGTACAAGATAAAATACCTTGCATG
AGAGAGAAGCTTCAATCCATAAATACTGAAAAATTGTCTGATTTCATTCAAAGTATTGAA
GCTTATTTCATCATCAATGATCAAGGCAAAACTGGTTCAGATCATGATGAATAAAATGGG
AAGTAAAAGAAAATGCTAAGGGGCGACAAGAATTAAAAAGGAAAAGTTGGCTTTGAAATT
GTGAAGAAACTAAAGAACAATCCCAATTCAAAGATAGGTTTTTAATCAGCTTTGATAAAG
AAGTTAAATTAAGATGTGTAAGAATATTGCAACAAAAAGATTCTAGAATTTAAGAACAGA
TTCTCTCTTGGCGGGATTAAGCTTAAATAAGATAGTTTGCTTGGTTGGTATCTTGAGGTA
AAGAAAGAGACTTATGAATAACATTCAGAACTTTTCAAGGATTATGTAGCTTGTAAAACT
CTAAAAAATGTCATGCAAGTCGTAGATCCTCAGATTTAAATGCTTAATGAAAGGATAAAC
TAGCTTTTGATTTGCATAAATATGGAAATGCAGTTGCTTCTTGAGGAGACAATATTCAGG
CATATAAAAGAAACTCAAAGTGAAGCAACTAAGGTATTTCAATTGATAGCCAGACTTGAT
GTTTCACTTGCTTTTGTGAGATTCATTCAAGAAAGCAAAGTTAAATTTGTGAAACCTAAA
ATTGTTGAGAATACTATGAGTAATTAAGGAAGTATGGAGTAACCTATTGTTTATGCTAAG
GAAGCTTATCATCCATTACTTTAACTAGCGAGGAAACCTGAAAATATCACTAATAATGAT
ATTTATTTGAATAATCTATCTTCAAAGTTAACTCTCTTAAATGGCATGAATGGATCAGGA
AAGACTACTTTCTTAAAAACTATCTAGCTTTTGATTGTTCTTGCTCAAATAGGTTGTTAT
GTACCAGCTTCAGAATTTATCTTCACTCCTTTGAACAGTATGTATTTGAGAGCTGGCACT
GAAGACAGCATAGAACGAGGTCTCAGTAGTTTCAAACAAGAAATGCAAGAAATTAGTAAT
GTTTTAAATCAGCTGCAATAGCATTCCACAAGTCAAACTAGTAATAATTAAGCACAACAA
AAGTAGAAGCATCTCTCTTTGATTTGTTTTGATGAATTAGGCATTAATACCTCATTAGAA
CAAGGTTTCCCACTCATGTGGTCAATATGTGAGCATTTACTAAAGTTATCAAATTTAGTA
ACTATGATTTCTACTCACAATTAACTTCTGAATTAGCTGGCTTTGATTTATCCCTAGGTT
CAGAGAATGAGAGTTGAAATGAATTTATTAGAAACTGGAAACAGTCACACCACTAATAAT
CACAAAGTGGTTGTTTGGAAGGATGGTAATAATGATAACAGAAATCATGATCAAGAGTTA
TCTGATGATACTCAATTGGATGAGAAGCAGTTTAACTATTTCTTTTTCAAGAGATTTAAG
GAGATTAAAAGCAGTATGATGAGCAACTATGAGTCGAAGTTTTTCTATGAATAAAGTGGA
TAAATTAATTAATCTGTTGGAAATAACAAAGTAAAGGATTAATAAAAAGTATTAACTAAC
TATTCTGATAAATTAAAATCGATGATAACTTAATGA


>Contig848.0.g75(protein)
MRRLSENPIYQRYDTQFLQSQNNQITAKISPQKNQIINLLEPQQDGDLDFEQSNINRNSN
NLNELQFDGEIECQGYTSIAAISENRGREVGIALYTPFKNRITLCQLVDSALYNQTVMIL
NKFEVKELVMSLKPEKFHILSNLALKYEKLIFIDRSDFNEQSGYDLLKEFVSDSKLLESC
PSNYVSITCLSALLLHLEANHKIQLDSSITNLTFFQSSNSLYIDQSTCQKLSLISLSGDS
KKDSGITLQSLFKTINPLGQKLLRRMIVSPSANPSKLNYYYEILETLLNSHSKTNLCILL
QNYIKQMNQIESSHTQIVYVMRRYTVKRPITFLSNLIRFIHKLKQFFALMSLVQDKIPCM
REKLQSINTEKLSDFIQSIEAYFIINDQGKTGSDHDEQNGKQKKMLRGDKNQKGKVGFEI
VKKLKNNPNSKIGFQSALIKKLNQDVQEYCNKKILEFKNRFSLGGIKLKQDSLLGWYLEV
KKETYEQHSELFKDYVACKTLKNVMQVVDPQIQMLNERINQLLICINMEMQLLLEETIFR
HIKETQSEATKVFQLIARLDVSLAFVRFIQESKVKFVKPKIVENTMSNQGSMEQPIVYAK
EAYHPLLQLARKPENITNNDIYLNNLSSKLTLLNGMNGSGKTTFLKTIQLLIVLAQIGCY
VPASEFIFTPLNSMYLRAGTEDSIERGLSSFKQEMQEISNVLNQLQQHSTSQTSNNQAQQ
KQKHLSLICFDELGINTSLEQGFPLMWSICEHLLKLSNLVTMISTHNQLLNQLALIYPQV
QRMRVEMNLLETGNSHTTNNHKVVVWKDGNNDNRNHDQELSDDTQLDEKQFNYFFFKRFK
EIKSSMMSNYESKFFYEQSGQINQSVGNNKVKDQQKVLTNYSDKLKSMITQ