Identifiers and Description

Gene Model Identifier

Contig22029.0.g67

Standard Name

MSH2

Aliases

Contig22029_0_g67

Description

MutS domain V

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002959209.997093137033517e-262MutS domain III family protein
SGDYOL090W7.997898791454654e-149MSH2 SGDID:S000005450, Chr XV
from 147382-150276, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22029.0.g67(coding)
ATGCAAGATTAAGTGACCTTCTCGAAAGAAGATGCTGGTGAGATAAACTAGACTTTACTA
GCAATTAACTTCAGGATTACACAATCAGAACGTCTGGTTGGTGGATCATTTATCAATATG
AATGAAAGGAGTCTTCTGATTACTGAGTTCATGGATAACGAGCACTTCTCAGGTTTAGAA
TCTCTAATTATTCAGCTTAACAACTCCTCTCCAGATTCCAAGTTCAAAATTCTCGTTAAC
ATGCCAACAGATATACTCAAGGATAAAGTTTAAGATATTCTAGGCATGTGTGAAGTAGAG
TATGTGATGGGAAACAAGAAAGACTTCTCATCAAACGGAATTGAAAATACTCTTAATAAC
TTATTGAAAGAGAGCTACAATTACAAGCTTGAAGAATCTGAAATGGATCTGGCTCTTGCC
GCATTATCAGCAGCTATAGAGTATATGCACCTTAAAACTGGCAAGCAAAAGTAATTCTCG
CTAAAGAAATACACTCTAAGTTAATATTTGAGACTTGATGTAGCTGCACTTAAAGCACTG
AATGTTTTTCCATAAAGTTCAGAAGGTGTATCTGGACAGGGGAGCTCTTTATATTCTCTA
TTAAATTAGACTAAAACTTCAATTGGTAGTCGCCTGCTTAAAAAGTGGCTAAAATAACCA
ACTACAAATAGAGATGAGATCAATCAAAGACTTGCAATTGTCGACTATTTATATATGAAT
GACCATGTTAGAAAAGATATCTCTGCTATTCACTTGAAAGCTTTCCCTGATTTGGAGAAG
TTGTATGCAAAATTCTACAGAGTACAAATGAAATTGAGAAACAACGCTCAGTTGGTTGAT
TGTGTAAAAGTCTACAATATGATTTTTACTTTGGAAGGACTTTGCAAATATTTGGATGAG
AGTATCATGGATGAAAATCATCCTCTTAGAACTGTAATCTTAGACCAGTTAAAAGGAACA
TTGGAGGATTTCTTTAAACTTAAGGAAATGCTTGAGTAATGCATAGATATCGGTAAAGCT
AAGCAGAATGATTACATAATCAATCCACAATTCAGTCCAGACCTTAAATAGATTGATACT
GATATCAATAAAGTTAAGAAGAAGATTGAGGATTTGAGAAGAAGAGTAGAAGATGATTTG
TAATGCAACAAGCCAGTAAACTTGATTGAATCCTAAATGCACACTTTTATCTTTGAGTGT
GACAAGAAAGAGGGAGACGCTGGAATGAGAAATAGTCACAAGAAATTCAACTATAAGATT
ATTTCAATTAAGAATAAAATCATGTCCTTCTCAGTGACTGAACTTAAAGATCTTGTCCGT
GAGTATAACGAACTGGAAGATAACTACAGAGCCTTATAAAATGAATTAGTGATGAAAGTC
TTGGAAATTGCATCAACATACTACCCACTTTTGGAATAAGTCTCTTCGCTAATCTCTCAA
CTTGATGTTTTAAGTGCATTCGCATCAGTTTCTTCAACTCATTAGTATTGCAAGCCAATA
ATATGCCCAGAGGGTAAAGAACAGATATATCTTATTGAGAGCAAGCACCCACTCATTCAT
TATATTGATCCAGCTTCCTGCATAAATAATGACTGTAGAATGCAAAAGAATCAATCGAAT
CTTCAAATAATAACAGGACCAAACATGGGTGGAAAGAGTACCTATATCAGATAAGTAGCA
ATCTGTGTATTGTTGGCTCACATTGGATGTTTTGTACCATGTGCAAAGGCAGAGATCCCT
ATCGTAGATTGTATTATTGCGAGAGTGGGTGCATCAGACCATTAACTTCGAGGAATATCT
ACTTTTATGGCAGAAATGCTAGAAGCCTCATGCATGCTTAAGACTGCTACTAACAGAAGT
TTGATTATCATGGATGAATTGGGAAGAGGTACTTCAACTAATGAGGGATTTGGATTAGCC
TGGGCTATAGCAGAGTACATCGCAACTGAAATCAATTGTTTCTGTTTATTTGCAACACAT
TTCCATGAAATGACAGCAATGGAAAAAGAGTTGCCTAATGTAAAGAATAGATATGTGAGT
GCCCTTGCTCATGGTGATTAACTAACTATGCTCTATAAAGTTAAAGATGGAGTCATAGAT
CGATCATATGGTATTCATGTAGCAGAGATGCTCAAATTTCCTGAAGAAGTCCTCAGAGAA
GCCAAGGCACTTGCTTCAGAACTTGAAAACTTTTAAGAAATATCATATAAGGCAATATAG
TGA


>Contig22029.0.g67(protein)
MQDQVTFSKEDAGEINQTLLAINFRITQSERLVGGSFINMNERSLLITEFMDNEHFSGLE
SLIIQLNNSSPDSKFKILVNMPTDILKDKVQDILGMCEVEYVMGNKKDFSSNGIENTLNN
LLKESYNYKLEESEMDLALAALSAAIEYMHLKTGKQKQFSLKKYTLSQYLRLDVAALKAL
NVFPQSSEGVSGQGSSLYSLLNQTKTSIGSRLLKKWLKQPTTNRDEINQRLAIVDYLYMN
DHVRKDISAIHLKAFPDLEKLYAKFYRVQMKLRNNAQLVDCVKVYNMIFTLEGLCKYLDE
SIMDENHPLRTVILDQLKGTLEDFFKLKEMLEQCIDIGKAKQNDYIINPQFSPDLKQIDT
DINKVKKKIEDLRRRVEDDLQCNKPVNLIESQMHTFIFECDKKEGDAGMRNSHKKFNYKI
ISIKNKIMSFSVTELKDLVREYNELEDNYRALQNELVMKVLEIASTYYPLLEQVSSLISQ
LDVLSAFASVSSTHQYCKPIICPEGKEQIYLIESKHPLIHYIDPASCINNDCRMQKNQSN
LQIITGPNMGGKSTYIRQVAICVLLAHIGCFVPCAKAEIPIVDCIIARVGASDHQLRGIS
TFMAEMLEASCMLKTATNRSLIIMDELGRGTSTNEGFGLAWAIAEYIATEINCFCLFATH
FHEMTAMEKELPNVKNRYVSALAHGDQLTMLYKVKDGVIDRSYGIHVAEMLKFPEEVLRE
AKALASELENFQEISYKAIQ