Identifiers and Description

Gene Model Identifier

Contig5504.0.g72

Standard Name

MRT4

Aliases

Contig5504_0_g72

Description

Ribosomal protein L10

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011515509.998397555368434e-52hypothetical protein
SGDYKL009W3.0013534825799953e-36MRT4 SGDID:S000001492, Chr XI
from 426242-426952, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5504.0.g72(coding)
ATGCCAAAGTCAAAGAGAAACAAGATCGTGTCCCTCACCAAGGTCAAGAGAAAGGGAAGA
GAAGCTAAGGAAGAGCTCGTTGAAAAAGTTCATGAGGCAGTTGAGAAATACAAGAATTGC
TTCGTTTTGCAGTTTGATAACATGAGAACTGGTCCATTCAAGAACATTCAGAATGCTCTG
AGAGACAGTAAATTCTTCTTGGGTAAAAATAAAGTCATGCAAGTCAGTCTTGGCAAGTCC
CCAGAGACCGAGCCCGCTGACAACACTCACTTGATCTCCAAGTACTTAAGAGGACAGGTT
TGCTTGTTGTTCACAGATAGAACTGAGAAAGAAATCTAGAAGTTCATTGAGGACAATAGA
CTACCAGACTACGCAAAGGCAGGCACTAAAGCTACCTTTACTGTATTCCTAGAGAAGGGT
GTGCAAGCTCTTGACGCATACGGTCATGGTATGGAACCTTACTTGAGACAATTAGGACTC
CCAACTAAGTTGAATATGCAGAAAATTGAGCTCTTAGCCGATACTTATGTGTGCCGCGAA
GGCGAGGAATTAAGTGTGGAGTAATGCAAGATCCTGAAGTTACTCGGTCACCAGATGGCT
AAGTTCAACATGATTATCTTAGCTACTAGAACAGACAAAGGAAAGTTCAAGGAGCTCGAA
GCTGGTAGATAATTCTTGTAACATAACAAAGAGGATGCTGAATGA


>Contig5504.0.g72(protein)
MPKSKRNKIVSLTKVKRKGREAKEELVEKVHEAVEKYKNCFVLQFDNMRTGPFKNIQNAL
RDSKFFLGKNKVMQVSLGKSPETEPADNTHLISKYLRGQVCLLFTDRTEKEIQKFIEDNR
LPDYAKAGTKATFTVFLEKGVQALDAYGHGMEPYLRQLGLPTKLNMQKIELLADTYVCRE
GEELSVEQCKILKLLGHQMAKFNMIILATRTDKGKFKELEAGRQFLQHNKEDAE