Identifiers and Description

Gene Model Identifier

Contig14282.0.g82

Standard Name

MRPS9

Aliases

Contig14282_0_g82

Description

Ribosomal protein S9/S16

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006701702.998800627344286e-26ribosomal protein S9 containin
g protein
SGDYBR146W0.000000000003001226732525078MRPS9 SGDID:S000000350, Chr II
from 535260-536096, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14282.0.g82(coding)
ATGTTCACCCACAAGCTATTAAAGACTCAGCAACCCCTGAGTACTATGCATACTATGAGA
GTGCAGAATTTCGCTAGGTATTTAAATCGCAGTGAGAAAATGCAGTAAACTTACAAATAC
GACCCCACTGCCTACGAATACCGCCCTAACATGATTTATAACATCGATCCCGCACCCCAA
TACCCCGACGACCCAATGGGCCCAAAGTCTCTCTATGAATGGCAACGCAGAAGAACTGTC
AAATTGATGCAAGAAAAGAACAGAGATAACACTATGATTAGAGATAAGCTGAGAGAAAGA
TATCATCATGGTCGTCTCTTCGCTCACTTGAAGCAGCAAGATATGAAGGATACAGTTCAG
AGCATAAAGAACAAGGAACTCGGAATTGATGATGAGGTTAATGTTGCATCACTGAGAGTG
GAGAAGGGTATTTAATTTGATGTACCAGAGGTTGAAGACACCTTCAAACTTCCTTATAAT
GTTGGTTTCGATCACATCATCAAGTAGAAAACTGATATATTGAATCAGCAGAAAACTCTT
AATTTTCAGGCTATGAACGAATTAGTGGAGAAGCTTGGCTATATGGATTACAGAGATGCC
CTCGCTTGCAACAAATACATTCTTGAAGCTAAAAGACACGGAGATTATCATTAATTAGCC
AGAGCTTAAATTTTAGGTGTTGCTATGGCAAAGTTCAATTTCAAGAAAAAAGAGGAGCTT
GAAAAAAGTACATAAAAACATCCATTAGCAGCAACTGACAAAGATCAAGCTAAATTTGAA
ACTGTACTAAACTTAGACCCTAAGTTGGGCAATTTGTACAGAGACACCTACGAGAAACTT
AAAATGGACAAGGAAGTCGATGAAATTATAGCTGAGGACTTGTATGAAAAGTACGACTAT
CTGCACGATAAGGGCTACTAGGACTTGAGAGAGGTGAATGACGAGTTCGACCCCACAGCT
CACGACAAAGAAAAGTATGAAGATTTATTCACCACTGATATGTCTGACGTTGAAACTGAC
TTGATCTACAAGAGATATAAGTTGATGAGAGAGCAGGAGAAGATCAGTCTTGATGACCTC
AGAGACCAAATTAAAGTGCTTACTATGAATATGGGTTAGAAGAAAGCCATAGATCCATTC
AGAAAGGATGGCTCAACTATTAGGTCTATTGAAGACTATGAAAATATTATCAGCAAGCTT
TATAAGCAAGAGGATACAAAAATGAGAATTTAAGCTAAACTTGAAGATTTCATGAGCACC
ATTAGATTCACACATGAAATGAGAAAGATCCAATTCGATGAGGTGTACAACCTAAAAGAC
CCATATTTCCCAGGTGAGCTCCCAGAAGATAGATTCGGACAGGAGGATAATATAAATCAG
CCACTGGAAGTCAGAAAGGCTCTGTCCATAAACTACTAAGAGGATCAAATACTCGATAGA
TTAGTGTTTGATAGAGACAGTGGAGAGGCAGTAGAGGGCTATGAGGAGTATATCAAGCAG
TATTTCAGAGCCAAATATGATGCCTATATTCAGTCAAAACTATCTCAATTCAGAGCCACA
AACAGAGATCTTGAAAATAAGCTTAGAGTTGCAAGTGAAAAGGACCCTATGATTTAAAGA
AGAGCTGAGTTTATGTTTAACTACATGGACTACCGTAACGACAGATATCGCGTTCGTGAA
AAGTTCATAAATGAATATAATAAAAAGACAACCCTACAAGATATTGGTCAAATGCTCGAC
AAATTCATTGTTGAAGAGAAAGGTGAAATGTTCAAATACGCTTCTCCAGAGTACGAAGAT
AATTTAAGATATCCAAAGAAGGACCAAAGCAACTTAAGTATGAGTCTTTTTGGCCACATC
TTAGAAGGCAAGAGTCCCTTAAAACCACACTTGCTAGATGACAAAGAAAGACTTGACACT
GTCCCTGAAGGACAAGATATCAGAGCAAGAGACATTTTAGAAAGAATTAAATATGAAGAC
TCCCGTACCGAGCACTCATTCGATACATTGACACCAGACCAACGCCTAGAAATCCAAATG
TTCCACTCCTTCAAGCAAGACCCCTACTTCAAACATTACTTGTATAACAACTTCAGGTAA
TTCTCTGAAGAAATGGATGATACCTTTGGCAGCTTCCCAGGTCCACAAACTAACAACATG
CTTTATGATGTTCCTAAGTTTGATAGAATTAATCTCTATGATTTCAGAAGAGCTTTACCT
CAGAAGGAAAGAGAAAGTAAATTGGATAGCAAGGGTTGCGCTTGGGGTTTCGGTAAACGT
AAAAGATCTCAAGCTGTTGTTAGAGTCAAACCTGGAAAGGGTATTATTAACATTAATGGT
ATGAGCATGCTAGAATATTTCCATCAAGCTCATCAGAGATATAGAATTCTATTGCCATTA
ACAGTTACTTAATACACTTGTCTTCTTGACATAGATATCTGGACTCATGGTGGTGGTACT
ACAGGGCAGTGTGAGGCATGTGTACCAGCTATGGCCAAGGCAATCTAGAACTATGACGTC
AAAACCAGACCAATTCTGAAATTCTTCAAGTTAATGCGCCACGATGGAAGAAATGTTGAG
AGAAAGAAGCCAGGTCTCATTAAGGCTAGAAAGGGTCAAGTTTACAGAAGAAGATGA


>Contig14282.0.g82(protein)
MFTHKLLKTQQPLSTMHTMRVQNFARYLNRSEKMQQTYKYDPTAYEYRPNMIYNIDPAPQ
YPDDPMGPKSLYEWQRRRTVKLMQEKNRDNTMIRDKLRERYHHGRLFAHLKQQDMKDTVQ
SIKNKELGIDDEVNVASLRVEKGIQFDVPEVEDTFKLPYNVGFDHIIKQKTDILNQQKTL
NFQAMNELVEKLGYMDYRDALACNKYILEAKRHGDYHQLARAQILGVAMAKFNFKKKEEL
EKSTQKHPLAATDKDQAKFETVLNLDPKLGNLYRDTYEKLKMDKEVDEIIAEDLYEKYDY
LHDKGYQDLREVNDEFDPTAHDKEKYEDLFTTDMSDVETDLIYKRYKLMREQEKISLDDL
RDQIKVLTMNMGQKKAIDPFRKDGSTIRSIEDYENIISKLYKQEDTKMRIQAKLEDFMST
IRFTHEMRKIQFDEVYNLKDPYFPGELPEDRFGQEDNINQPLEVRKALSINYQEDQILDR
LVFDRDSGEAVEGYEEYIKQYFRAKYDAYIQSKLSQFRATNRDLENKLRVASEKDPMIQR
RAEFMFNYMDYRNDRYRVREKFINEYNKKTTLQDIGQMLDKFIVEEKGEMFKYASPEYED
NLRYPKKDQSNLSMSLFGHILEGKSPLKPHLLDDKERLDTVPEGQDIRARDILERIKYED
SRTEHSFDTLTPDQRLEIQMFHSFKQDPYFKHYLYNNFRQFSEEMDDTFGSFPGPQTNNM
LYDVPKFDRINLYDFRRALPQKERESKLDSKGCAWGFGKRKRSQAVVRVKPGKGIINING
MSMLEYFHQAHQRYRILLPLTVTQYTCLLDIDIWTHGGGTTGQCEACVPAMAKAIQNYDV
KTRPILKFFKLMRHDGRNVERKKPGLIKARKGQVYRRR