Identifiers and Description

Gene Model Identifier

Contig22518.0.g92

Standard Name

MRPS17

Aliases

Contig22518_0_g92

Description

Ribosomal protein S17

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00366 ) Ribosomal protein S17
  • ( pfam04859 ) Plant protein of unknown function (DUF641)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005852508.00284826019147e-27ribosomal protein S17 containi
ng protein
SGDYMR188C0.0000004998288985444982MRPS17 SGDID:S000004800, Chr X
III from 637004-636291, G...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22518.0.g92(coding)
ATGTCTAGCAGTATTTGGAACCTCACACATCCCCTAAGATCTGGTCATATTCCCTTGAGA
CCAGGTGGTTGCGAACTCTTCGGCACAGTTATCAGATAAGGCAGAATGAAAAAGACTGTT
TCGGTATTGGTAACCAGATATCACTTCAATCGCACTATTATGATTTGGTCAAGTAGAAAC
AACCTAAAGCATGTTCATGATGAAGAGGGTTACTGCCGCACAGGCGATAAAGTAGTGATC
AAGTCTTGCAGGAAAATCAGTCCAATCAAGCACTACTATGTCAGAAACGTGGTTTTGCCA
GTGGGTAGAGTAAATATCTATGAGAAGGACATCACACAGTACGAGAGAGAACAAATTAAA
TACAATGAGCAACTAAGATCCATAAATAAGTTATATTGA


>Contig22518.0.g92(protein)
MSSSIWNLTHPLRSGHIPLRPGGCELFGTVIRQGRMKKTVSVLVTRYHFNRTIMIWSSRN
NLKHVHDEEGYCRTGDKVVIKSCRKISPIKHYYVRNVVLPVGRVNIYEKDITQYEREQIK
YNEQLRSINKLY