Identifiers and Description

Gene Model Identifier

Contig1412.1.g87

Standard Name

MRPS16

Aliases

Contig1412_1_g87

Description

Ribosomal protein S16

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004443302.0009605191578312e-25ribosomal protein S16 containi
ng protein
SGDYPL013C0.000006997203421143941MRPS16 SGDID:S000005934, Chr X
VI from 529350-528985, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1412.1.g87(coding)
ATGAGAGTCAAGATAAGACTTAGAAATGAAGGTTGCAAAAATCATCCCTTCTGGTGGATA
TTAGTTCAACCAGAAAACAAAGGTTTGAAAGGAAGATATCTTGAAAAAATTGGGTACTGG
TTACCTAGAAAAACAAAGACTGTATAGAGAGCAATTATTCTAAATAAAATGAGGGCTCAA
TATTGGTTAGGACATGGTGCTTCACCAACTAAAGGAGCTCACAGACTACTGGAAAAGTTT
GGATTTGTCCCCAAATACCCTGCACCATTCGGTAACAAAAGTCTCTATGAGAAACCCGAA
AAAGAATATAAACCAGACTACTTCAAGTTCAAGGAAGGCAAAAAAGATGATAAGAAAATA
GAGGTCCGCGCTCTTATGCAAGATCAAATGAATATCTTAGAGAGAAAACGTAGAATGAAT
TTGGAAGCCTCAGAAGCACTTGGTCTCGATCAAACTGACGCAGCAATTTTAGATTTAGAA
GGTGCTAGAACTACAGATATCGAATCTGAGGAAGCAGATATTTTTGAGAGGAAGCGCAAA
TTTGACACACTCGTTAAGAGAATCGATAAACATAGAAAGGAAACTATGCATCTTAGAGGT
AATGATCTTAGATACAATATATACATGAGAAAGCTACAAAAGTTGACCAGACATGACTTG
GGTTTGGATATTGAGGCTTATAGAGATTATGTAAATAACTTGAAATAGTTCGCTCACATC
AATGAAGACTATGAATTATTCGCAAGAGAAAAGCTTGTTATTGATGAGCCAGGATATAGA
CAAATTGTCTAAGCTGGTATTGAAGGGGAGACAGAAGAATAAAAACTTGAAAGAATGAAG
TTTGCTTTTAAGGTTTCAGAGATCAATAACACTATCAGAAAACTAAAGCGTGAAGCAGCC
AGTTTCCTAAACGATAAGGACCGCTCTCTACTCAACGAGTTTGTGAGAGACATGAAAAAA
TATCTCGAAGATTTTGAAACTTTCCAGCTCATGCAGGAGATGTACAGAAAGAGACTCGAG
GATATCGCAAAGAGAGAAGAAAGAATCACTTTGAACATTGACAAAGTTAAGGATAGGGAT
CTTGAGGATGCTAATGTCTCCAAGAGAGAATTTGAACAAATCAAGCTTTTACTCTCAGTT
GATGCTGAAATATTCAAGCCATCAGATTTCACATCAGTTAGTCCTCATGCTAACGTTATT
GATCTTACAAAGTATCCTAGCTTACCCAAAGAAGCAAAAGATATTATGTACAGACCTCCA
AAAGTGAAGATGCTCTATGAGAAATATTGGTAATTAGCAAATCAAGTGCACGGCAGAGTG
AAAGAAGAGACCGACAGCAAATACATAAAAGAGAGACATCCCAGATTCCCAAAGAAAACC
ACAGAGGAAATTATCTTCTTGGATAAGATCTTCTAAAAATTAGAGCTTGTGATTGATGAA
AATCAGAGAGAAATTCATTAATTCATGTAAAGCGAAGAATACAAGAATTAAATCGCTTAA
AGAACCTAAAGAGTGGAGAGGAAGACAGAACTTGAGGAACTCCGCAAACGCATAAAGGGC
GATCTCTATCACGAAGACGCCTTCACCGAAGCAATCGAGAATTACAAGAATATGACCCCA
GAAGAGAAGAAAGCACTTAGAAAGGGTGATGATTTAGATGACATTCCAACTTCAGATGTT
GAAAAGTTCTATACTCAAGCTTATAGCAGTGAAGATGAGGAATACCCTGACGATGAGGAA
ATCAGAGACTTCTATGAGACTAATAGAATTGACTTAGCCAGAGCTTTCTTAGGCAAGAAG
GGCGGCTATTCCATGAGAGACCTCAAGAAGTTCTTCAGACAAACTCAATTATACAAGCCA
CTTAAGTATGATGATGAGGGAAAGCCAATAACTCCACTCTACGATGAAGAAGCCTACGAT
AAGGAGACTGAGGAGTTAGACGTCAAAGACCAAGATGAAAACAGTGGAGACATGGAAGAC
GAGCTTTCAGGCACTAAAATAGTCAAGAAACAGGCAGCTAAAGCACCAGCAGAGGCTAAA
GAGCAGAAACCCAGAGCTGCAGATGGCAGACTCGAGAAGTACTCAGATGAGAGCGATGAA
GCAGAGTTCAACCCTGAACTTGAAGGCATTCACAAGGATAAACTTGATTAATTAGAGGCA
TTGATTATGGGATTCCCAGAGGAGCCTACCAAGGAGCAACTCATGGAATTCGGTTAGTTA
TTGGCTAAGTTAACTAATGTCCGTACTCACAGAGACAACAGACCAAAGGGCCATATCAAG
GAGGATGATGTCTACGCCAAGATGGATAAAGACGAAATGAGCTTGGTTCATCCAGTCGCT
GAGGGCCCAACCAAGAATGACCCTCCATTCTTCACATACGACGATCAAGTGCGCATCTAC
GAGATGTTGAACAAGTAAGTATGCAGATATCCCAAAGGATACAGGCAGTACGAGTGCTAT
GACTTCTACAGAATCCAAAACCCTGGCTCAACCATGCAGGAATATCACGAAGTCATGAAT
AAAGAAATCACTTTTGATGAGTACTTAAACCTCGTCAGAAGTGTGTTCTTGGAGACATCT
GAAAACCCAGTTATGAAGACTCTCTTTAACATGCCATTTGATGATTTTGTCGAAGATGAG
AGCGATGCACTGCTTCCCCATGAGTTTGCTGAATCACATGAATTCAGAGATAGCTGCAAA
TAATTCTTTACCGAGAGAGTGAATGAGGCTCTTTTGGATAGAAGATGGTTCTCAAAGGTT
GACGCCATTGAGGAACTTATTAATTTATATGAGTATGGCAGCAATATTCACTCAATCCCA
CACGGTAACTTCTATGTGCCATCAAAGACCACAATTATGAAGAGACCAGACTTATCTGAT
GAGAGAAAAGACGATATAAGTTATCAATACGGCCAATCCCGTGTCTCACCCTATTTCTAC
CAAACTGGTGTCTTAAAGGGCTATCAATAATCACCAAATGCCCCTCCCAAATACATCAAG
AATTTGTATAAGACTAAGAAGTTCATGAAAGACAACAGACTCTCCCGTGGTTTCAGACAT
ATCGGTCTTTTCTCAACTGTTAATAATAGAGTGAACTACGACGAAATGAGCAAGGAGGAG
CAAGTATTATTCGATAGAAAGCAGACCTTCTTATTAATGAAGTTTGATGCCACTGTTAAT
ATGGACTTTGGTATGGGAATGTTTAATTAATTTGAATGA


>Contig1412.1.g87(protein)
MRVKIRLRNEGCKNHPFWWILVQPENKGLKGRYLEKIGYWLPRKTKTVQRAIILNKMRAQ
YWLGHGASPTKGAHRLLEKFGFVPKYPAPFGNKSLYEKPEKEYKPDYFKFKEGKKDDKKI
EVRALMQDQMNILERKRRMNLEASEALGLDQTDAAILDLEGARTTDIESEEADIFERKRK
FDTLVKRIDKHRKETMHLRGNDLRYNIYMRKLQKLTRHDLGLDIEAYRDYVNNLKQFAHI
NEDYELFAREKLVIDEPGYRQIVQAGIEGETEEQKLERMKFAFKVSEINNTIRKLKREAA
SFLNDKDRSLLNEFVRDMKKYLEDFETFQLMQEMYRKRLEDIAKREERITLNIDKVKDRD
LEDANVSKREFEQIKLLLSVDAEIFKPSDFTSVSPHANVIDLTKYPSLPKEAKDIMYRPP
KVKMLYEKYWQLANQVHGRVKEETDSKYIKERHPRFPKKTTEEIIFLDKIFQKLELVIDE
NQREIHQFMQSEEYKNQIAQRTQRVERKTELEELRKRIKGDLYHEDAFTEAIENYKNMTP
EEKKALRKGDDLDDIPTSDVEKFYTQAYSSEDEEYPDDEEIRDFYETNRIDLARAFLGKK
GGYSMRDLKKFFRQTQLYKPLKYDDEGKPITPLYDEEAYDKETEELDVKDQDENSGDMED
ELSGTKIVKKQAAKAPAEAKEQKPRAADGRLEKYSDESDEAEFNPELEGIHKDKLDQLEA
LIMGFPEEPTKEQLMEFGQLLAKLTNVRTHRDNRPKGHIKEDDVYAKMDKDEMSLVHPVA
EGPTKNDPPFFTYDDQVRIYEMLNKQVCRYPKGYRQYECYDFYRIQNPGSTMQEYHEVMN
KEITFDEYLNLVRSVFLETSENPVMKTLFNMPFDDFVEDESDALLPHEFAESHEFRDSCK
QFFTERVNEALLDRRWFSKVDAIEELINLYEYGSNIHSIPHGNFYVPSKTTIMKRPDLSD
ERKDDISYQYGQSRVSPYFYQTGVLKGYQQSPNAPPKYIKNLYKTKKFMKDNRLSRGFRH
IGLFSTVNNRVNYDEMSKEEQVLFDRKQTFLLMKFDATVNMDFGMGMFNQFE