Identifiers and Description

Gene Model Identifier

Contig17785.0.g85

Standard Name

MRPS15

Aliases

Contig17785_0_g85

Description

Ribosomal protein S15

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001578101.999598840915195e-17ribosomal protein S15 containi
ng protein
SGDYDR337W0.000050024383570459175MRPS28 SGDID:S000002745, Chr I
V from 1146319-1147179, G...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17785.0.g85(coding)
ATGAGTGGCTTGGCTTTTAGAAATGCTTACTTTACCCAGCAACCAGTTGCTGCAACTAGT
ATGCTCTTGAACTAGACTTAGAGGGATTTCGGTGCTGCCACTAAAAAGAAGGGACATAAT
GATTTTATTCAGAATGAAAAGGCTGAAGCTAAGAAATATGGAATTAAAAGAAGGTTTTAT
GATCATCTCCCAACTATTGCTAGGCAACTTCCAAAGTCTCAATATCGTAATGGATTGACT
GAGACTGATTTAGAAGGATATAATGAGGAAGTTAAGCAGTCTTTCAATATTATTAATGGT
AGTTATCACGAAGTTTACTAGGCTAGAGCTCACGAAATTATCAATATTTTTGGAAAGCAT
CAAATGGATGTGGGAAATAACGCAATTTAAGCCGCTGTATTATGCGAGAAAGTGGTCTCT
CTCTTGAATCACATGCGTGAGAACCACAAAGATGTGTCAGGTCTCATCCGTCTATAGAGA
TCTCTCGCCTAGAGAAGAAGATTCTTGTTTTACTTGAAGAACAACGATTTCCTTGCTTAC
GCTTAAGTATTGAAGATTTATGGACTCACTGATCTTAACAGCGACAAGGGAGAGGGTATT
CATAAAAACTTCAGATGCAGAAACTGGAAGTGA


>Contig17785.0.g85(protein)
MSGLAFRNAYFTQQPVAATSMLLNQTQRDFGAATKKKGHNDFIQNEKAEAKKYGIKRRFY
DHLPTIARQLPKSQYRNGLTETDLEGYNEEVKQSFNIINGSYHEVYQARAHEIINIFGKH
QMDVGNNAIQAAVLCEKVVSLLNHMRENHKDVSGLIRLQRSLAQRRRFLFYLKNNDFLAY
AQVLKIYGLTDLNSDKGEGIHKNFRCRNWK