Identifiers and Description

Gene Model Identifier

Contig232.1.g121

Standard Name

MRPL49

Aliases

Contig232_1_g121

Description

Mitochondrial large subunit ribosomal protein (Img2)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam05046 ) Mitochondrial large subunit ribosomal protein (Img2)
  • ( pfam01253 ) Translation initiation factor SUI1

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006163802.9993743585281133e-40hypothetical protein
SGDYCR071C0.00000019998969434520019IMG2 SGDID:S000000667, Chr III
from 240543-240103, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig232.1.g121(coding)
ATGGCCAGTCATTTCACAAAGTTCAAGGGTTTAAAGCTGAACATGCGCCACACTAATCTC
ACCAATAAATATATCGACCGCATGATTGTCAGGTAACCTCAAACTAAAATTGAAAATCTA
CATCCCAAGGTCAAGCAGAGATGGAATGAGATGACTTAACCACTCGAACCATTAAAGTAT
AAATTGTAGGAACTGCCTACTCCCGATTACACTCTCAGCAAGCCATTAGGCTACGATCAA
GCTATTCCCTTCCAGATCGAGAGAACACACTCAAACAACTTGCCAGTGTACACAGAATAC
AGAAACGGAGGAATGAAAAAAGTTACTATTGTTAGAAGACTTACTGGAGATGTAGATGAG
TTCACTCTTGAACTGAAGAAAGTTGTTTCAAATTCACCAATTGAAGAGAAAATGGGAAGA
GTCGAAATCAGCGGATTGCACACTGAGAAGGTGAAGCTATGGCTTAGAAGACTTGGATTT
TGA


>Contig232.1.g121(protein)
MASHFTKFKGLKLNMRHTNLTNKYIDRMIVRQPQTKIENLHPKVKQRWNEMTQPLEPLKY
KLQELPTPDYTLSKPLGYDQAIPFQIERTHSNNLPVYTEYRNGGMKKVTIVRRLTGDVDE
FTLELKKVVSNSPIEEKMGRVEISGLHTEKVKLWLRRLGF