Identifiers and Description

Gene Model Identifier

Contig14663.0.g55

Standard Name

MRPL47

Aliases

Contig14663_0_g55

Description

Mitochondrial 39-S ribosomal protein L47 (MRP-L47)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam06984 ) Mitochondrial 39-S ribosomal protein L47 (MRP-L47)
  • ( pfam00010 ) Helix-loop-helix DNA-binding domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001609607.996210139153865e-29hypothetical protein
SGDYLR439W0.0000000400154582995175MRPL4 SGDID:S000004431, Chr XI
I from 1014491-1015450, G...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14663.0.g55(coding)
ATGTCAATGAATTGGCACTACTTCAAAGTAATGAACCGCAGACCTCAGGTCACAATTCCT
AGAGCAGCTCCAGGTGGTCTCAAGGATCTTTATGATTTTACTAATTACAAGGCTGATAAC
AGATAGTATACTGGCAGTGGCCGCTCATGGAGGCCTGATGAACTTAGACTTAAGTCGCAT
GATGATTTGCATAAACTTTGGTATGTTTGCTTGAAAGAGAAAAACAAGTTGAAGAGTGAT
TTCTTGGCATGCAAACAACTCGGACAGCAGTTTTACGGTCACTCAGACATCATAAAAGTT
AAAGTGACTATGGCAAGACTTCTAACTGTTGTGAATGAGAGAAAGAAAGTCAGAAATGAA
TACAGAAAGCAACTCGAAGATGATTATATTAAATTGAAGAAAACCGAAGAAGCTGCAGCT
CACAAAGAAGAGCTAGAAAAGCTTAAGGAATAAGGCATCAAGGTTGCACCTACTGACCAA
GAAGTCGGAGATATGATTAGAGCAAGAGCTCAAAAGAGAATGGAGGAATACAATAAAATA
CTTGAAACACTTAAAGAGAAGACCACTAAGTTAGATGCTGCAGTCTCACCACTTCTCGAA
GAAAAAGATTTGCAACTTGTCGCAGCTGAAAACGCTAAACTAACTCAGGGAGACATTTTG
AGAATGTACGTGAAAAATCACAAAGATCTAGACTTGAAGCAAACACGTCAAGTTTTCGCT
AGAGTTCAAAGAGAGAGAGCCTCCCATGCAAAGGAGATATTCTTGAAGGAGCTCTCTTCA
TTGGGCAGAAAGATGAAGAGCTAAGATTGGGCTAGTGATGAAAAATCAAGAATTAAGAAT
AAGAGAGACCCATTAAAACTCAAACTCGAGCAGTTAACTTTATCTGACGTGTTCACTACC
CAAAGTTAAGCTTCTTAATAAGAAAAGATTGTATGA


>Contig14663.0.g55(protein)
MSMNWHYFKVMNRRPQVTIPRAAPGGLKDLYDFTNYKADNRQYTGSGRSWRPDELRLKSH
DDLHKLWYVCLKEKNKLKSDFLACKQLGQQFYGHSDIIKVKVTMARLLTVVNERKKVRNE
YRKQLEDDYIKLKKTEEAAAHKEELEKLKEQGIKVAPTDQEVGDMIRARAQKRMEEYNKI
LETLKEKTTKLDAAVSPLLEEKDLQLVAAENAKLTQGDILRMYVKNHKDLDLKQTRQVFA
RVQRERASHAKEIFLKELSSLGRKMKSQDWASDEKSRIKNKRDPLKLKLEQLTLSDVFTT
QSQASQQEKIV