Identifiers and Description

Gene Model Identifier

Contig12209.0.g45

Standard Name

MRPL41b

Aliases

Contig12209_0_g45

Description

PB1 domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12209.0.g45(coding)
ATGCAAATAATCACATTTGAAAACTAGCCCCTAAAGATTAAACCTGCTCCCACTGAGCTC
AAGCTTTTAAAGCAGCATTTAAAGACTACATTAAATATAGATTTCGATTAGGACTTGTAG
AAAAATTGGGATAACGCAAGAGATTCTTAGTTGTATAACAATACTCAATCTCAACTATAA
AATTAAAAGAGCTTCTTTGATAGACTTTAGGAAGACCAAAGTGATTAGCCAAAGAAAGAG
TATTTGTTGTTTTACATTGACAGTGAGGATGAGAAGATTAGTATATCTACAGATTCAGAT
TTGCAAGATAGTCTTACTTATAGAGACTTGAAAAATAGGAAAACTTTAAGAGTATGCCTT
GAGTATCCAACTATGCACAGACCAGTAGAACAGTTTAAAAATCTGATAAATTAACACAGA
AATGTTAAGAAACAGAGGAGATTACTCAGGGAATAGAAATTATAATAAAAGGCTTAATAA
GAACAAAAAAGGTAATTTGAGTAGTCCCTTAGGTTTGCTATCAGATAATAGATTAAAAAC
AGTATTGTATAAGAAATTCAGCAAGAGATTGTTAGAAAATCTTACATTGATAGTAGAAAG
AGCAGTACTGACTCACTTTCTTAAAATTAAGAAGTCTCAAGAAATATTTAGTCATAATTT
GATGAGGAATTCGTTAATGGTTTAACAAGTTTATTCAAATATAGAAAAGTAAACGATGTT
TAGGTAAATGTTTAATAAGAACCCGTTTCTTATTAAGAAAATTCTGTTATGGTGGATGAG
TAATATGAGCATGACAATCAATCGTTTTTAGATTAATAGGAGAGTGTATTTCAAGAAATT
TAAGGAAACGATGGTGTTCAAGTCTAAAATTAAGAACATAAATAAGTGGAGGCCTATATA
GAAAAGAATGAAAGTTTTTTTAATAAGCGGGTTGAAGTTTACATGGAAAAGAATCAGAGT
TTTTACGACTAGCAAAACCAAATAAATCAATCGAGCCTGCAAGACAACTGCTTCAAAGAC
AGTATGGCAAAAGTAACCTCCCTGTAGGATTTGATTGTAAAGGCTAATTTAGGTGAAGTC
CTAACTTTATCTTGGACTATTAAAAATACCTCCAAAAGGACATGGCCCTCTTAACCTTGC
TTGAGGAGTCAAAATTAAGATAGATATGGATTATTAAAGCCTTAGTAACTCGATTTTTTA
CTACAGCCAAATAAGGAGAGAACAATAGACTATAGCATAGATATACCTATGGAATTTCCA
GAAGAATTTATCTCTTTAAACCTTGGATTGTATGATATAAATACAAACACTAAGTTTGGA
GAGCAATTTCAAGCAGTGATTTAAATTCAAAAGAAATAAAGCCCAATAAAGCGAGAAAAT
TTGGCTTAATCAAGTGTGTTCTACAGCACTCACTAAGCCGAAAACTATTAATTAGAGGAG
TCTCAAATCATAGAAGACGGTCAAGATCTTTAAACCTCGATTATCATTGAAGAAGAAGAT
GATTAGAACATTGAAAGCTAGTTATAAGATGAAGAGGAAACAGAAGAGTTCTAAGTTAGA
AATTAAATGTAGATGCAGTTTTCACCATTAAGGTAGCCAATGGATATTTCACAGCATTTA
CTCATGATTGACAATATATTAAATGACCATAATGCTTTGAACGATGAGATTTGTGACTAT
CAGGATGGAACTGGAAATCCAGATCTCTATAAATCCAATGGCACCCAAAACTCTGACGAG
GACCGCTAAAAGCTCCTTGCTAATTAACAAAGAGAACAAGAGCTTGAGATGATGAAATTT
AATTAAATCATTAATGACATAAACAACGATATAATCAAAGAGCAGTCACCTCCCAAGCCA
AATATTGAGGGATTGCTTAAAGATTAATAAATCGAGAGCCCAAAAAGCTAGAAAAAATAA
CCTTAGCAGGAAGAGCTTATCGGACAGTAAAGTTTGGACAAAATGGAGAGTGTTGAAAGT
TCTCCTTCTACTGAATCAATTGAAATCATATGA


>Contig12209.0.g45(protein)
MQIITFENQPLKIKPAPTELKLLKQHLKTTLNIDFDQDLQKNWDNARDSQLYNNTQSQLQ
NQKSFFDRLQEDQSDQPKKEYLLFYIDSEDEKISISTDSDLQDSLTYRDLKNRKTLRVCL
EYPTMHRPVEQFKNLINQHRNVKKQRRLLREQKLQQKAQQEQKRQFEQSLRFAIRQQIKN
SIVQEIQQEIVRKSYIDSRKSSTDSLSQNQEVSRNIQSQFDEEFVNGLTSLFKYRKVNDV
QVNVQQEPVSYQENSVMVDEQYEHDNQSFLDQQESVFQEIQGNDGVQVQNQEHKQVEAYI
EKNESFFNKRVEVYMEKNQSFYDQQNQINQSSLQDNCFKDSMAKVTSLQDLIVKANLGEV
LTLSWTIKNTSKRTWPSQPCLRSQNQDRYGLLKPQQLDFLLQPNKERTIDYSIDIPMEFP
EEFISLNLGLYDINTNTKFGEQFQAVIQIQKKQSPIKRENLAQSSVFYSTHQAENYQLEE
SQIIEDGQDLQTSIIIEEEDDQNIESQLQDEEETEEFQVRNQMQMQFSPLRQPMDISQHL
LMIDNILNDHNALNDEICDYQDGTGNPDLYKSNGTQNSDEDRQKLLANQQREQELEMMKF
NQIINDINNDIIKEQSPPKPNIEGLLKDQQIESPKSQKKQPQQEELIGQQSLDKMESVES
SPSTESIEII